Cargando…

Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides

Molecules with an allylic amine motif provide access to important building blocks and versatile applications of biologically relevant chemical space. The need for diverse allylic amines requires the development of increasingly general and modular multicomponent reactions for allylic amine synthesis....

Descripción completa

Detalles Bibliográficos
Autores principales: Xiao, Wei-Guo, Xuan, Bin, Xiao, Li-Jun, Zhou, Qi-Lin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Royal Society of Chemistry 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10430692/
https://www.ncbi.nlm.nih.gov/pubmed/37592986
http://dx.doi.org/10.1039/d3sc03233g
_version_ 1785091027490570240
author Xiao, Wei-Guo
Xuan, Bin
Xiao, Li-Jun
Zhou, Qi-Lin
author_facet Xiao, Wei-Guo
Xuan, Bin
Xiao, Li-Jun
Zhou, Qi-Lin
author_sort Xiao, Wei-Guo
collection PubMed
description Molecules with an allylic amine motif provide access to important building blocks and versatile applications of biologically relevant chemical space. The need for diverse allylic amines requires the development of increasingly general and modular multicomponent reactions for allylic amine synthesis. Herein, we report an efficient catalytic multicomponent coupling reaction of simple alkenes, aldehydes, and amides by combining nickel catalysis and Lewis acid catalysis, thus providing a practical, environmentally friendly, and modular protocol to build architecturally complex and functionally diverse allylic amines in a single step. The method is remarkably simple, shows broad functional-group tolerance, and facilitates the synthesis of drug-like allylic amines that are not readily accessible by other methods. The utilization of accessible starting materials and inexpensive Ni(ii) salt as the alternative precatalyst offers a significant practical advantage. In addition, the practicality of the process was also demonstrated in an efficient, gram-scale preparation of the prostaglandin agonist.
format Online
Article
Text
id pubmed-10430692
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher The Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-104306922023-08-17 Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides Xiao, Wei-Guo Xuan, Bin Xiao, Li-Jun Zhou, Qi-Lin Chem Sci Chemistry Molecules with an allylic amine motif provide access to important building blocks and versatile applications of biologically relevant chemical space. The need for diverse allylic amines requires the development of increasingly general and modular multicomponent reactions for allylic amine synthesis. Herein, we report an efficient catalytic multicomponent coupling reaction of simple alkenes, aldehydes, and amides by combining nickel catalysis and Lewis acid catalysis, thus providing a practical, environmentally friendly, and modular protocol to build architecturally complex and functionally diverse allylic amines in a single step. The method is remarkably simple, shows broad functional-group tolerance, and facilitates the synthesis of drug-like allylic amines that are not readily accessible by other methods. The utilization of accessible starting materials and inexpensive Ni(ii) salt as the alternative precatalyst offers a significant practical advantage. In addition, the practicality of the process was also demonstrated in an efficient, gram-scale preparation of the prostaglandin agonist. The Royal Society of Chemistry 2023-07-25 /pmc/articles/PMC10430692/ /pubmed/37592986 http://dx.doi.org/10.1039/d3sc03233g Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by/3.0/
spellingShingle Chemistry
Xiao, Wei-Guo
Xuan, Bin
Xiao, Li-Jun
Zhou, Qi-Lin
Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title_full Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title_fullStr Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title_full_unstemmed Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title_short Practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
title_sort practical synthesis of allylic amines via nickel-catalysed multicomponent coupling of alkenes, aldehydes, and amides
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10430692/
https://www.ncbi.nlm.nih.gov/pubmed/37592986
http://dx.doi.org/10.1039/d3sc03233g
work_keys_str_mv AT xiaoweiguo practicalsynthesisofallylicaminesvianickelcatalysedmulticomponentcouplingofalkenesaldehydesandamides
AT xuanbin practicalsynthesisofallylicaminesvianickelcatalysedmulticomponentcouplingofalkenesaldehydesandamides
AT xiaolijun practicalsynthesisofallylicaminesvianickelcatalysedmulticomponentcouplingofalkenesaldehydesandamides
AT zhouqilin practicalsynthesisofallylicaminesvianickelcatalysedmulticomponentcouplingofalkenesaldehydesandamides