Cargando…

Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control

BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnose...

Descripción completa

Detalles Bibliográficos
Autores principales: García, Eduardo, Gil, Pedro, Miñambres, Inka, Benitez-Amaro, Aleyda, Rodríguez, Claudia, Claudi, Lene, Julve, Josep, Benitez, Sonia, Sánchez-Quesada, Jose Luís, Rives, Jose, Garcia-Moll, Xavier, Vilades, David, Perez, Antonio, Llorente-Cortes, Vicenta
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10450024/
https://www.ncbi.nlm.nih.gov/pubmed/37635956
http://dx.doi.org/10.3389/fendo.2023.1236487
_version_ 1785095099856715776
author García, Eduardo
Gil, Pedro
Miñambres, Inka
Benitez-Amaro, Aleyda
Rodríguez, Claudia
Claudi, Lene
Julve, Josep
Benitez, Sonia
Sánchez-Quesada, Jose Luís
Rives, Jose
Garcia-Moll, Xavier
Vilades, David
Perez, Antonio
Llorente-Cortes, Vicenta
author_facet García, Eduardo
Gil, Pedro
Miñambres, Inka
Benitez-Amaro, Aleyda
Rodríguez, Claudia
Claudi, Lene
Julve, Josep
Benitez, Sonia
Sánchez-Quesada, Jose Luís
Rives, Jose
Garcia-Moll, Xavier
Vilades, David
Perez, Antonio
Llorente-Cortes, Vicenta
author_sort García, Eduardo
collection PubMed
description BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnosed type 2 diabetes mellitus (T2DM) and determine the effects of metabolic optimization. METHODS: This single-center longitudinal observational study recruited patients with newly diagnosed T2DM (n = 29, HbA1c > 8.5%), and 12 healthy control, age- and sex-matched volunteers. sLRP1 and ANP levels were measured by immunoassays at T2DM onset and at one year after optimization of glycemic control (HbA1c ≤ 6.5%). RESULTS: T2DM had higher sLRP1 levels than the control group (p = 0.014) and lower ANP levels (p =0.002). At 12 months, 23 T2DM patients reached the target of HbA1c ≤ 6.5%. These patients significantly reduced sLRP1 and increased ANP levels. Patients who did not achieve HbA1c < 6.5% failed to normalize sLRP1 and ANP levels. There was an inverse correlation in the changes in sLRP1 and ANP (p = 0.031). The extent of sLRP1 changes over 12 months of metabolic control positively correlated with those of total cholesterol, LDL cholesterol, TG, TG/HDLc, and apolipoprotein B. CONCLUSIONS: Newly diagnosed T2DM patients have an increased sLRP1/ANP ratio, and increased sLRP1 and decreased ANP levels are normalized in the T2DM patients that reached an strict glycemic and metabolic control. sLRP1/ANP ratio could be a reliable marker of cardiometabolic function.
format Online
Article
Text
id pubmed-10450024
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-104500242023-08-26 Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control García, Eduardo Gil, Pedro Miñambres, Inka Benitez-Amaro, Aleyda Rodríguez, Claudia Claudi, Lene Julve, Josep Benitez, Sonia Sánchez-Quesada, Jose Luís Rives, Jose Garcia-Moll, Xavier Vilades, David Perez, Antonio Llorente-Cortes, Vicenta Front Endocrinol (Lausanne) Endocrinology BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnosed type 2 diabetes mellitus (T2DM) and determine the effects of metabolic optimization. METHODS: This single-center longitudinal observational study recruited patients with newly diagnosed T2DM (n = 29, HbA1c > 8.5%), and 12 healthy control, age- and sex-matched volunteers. sLRP1 and ANP levels were measured by immunoassays at T2DM onset and at one year after optimization of glycemic control (HbA1c ≤ 6.5%). RESULTS: T2DM had higher sLRP1 levels than the control group (p = 0.014) and lower ANP levels (p =0.002). At 12 months, 23 T2DM patients reached the target of HbA1c ≤ 6.5%. These patients significantly reduced sLRP1 and increased ANP levels. Patients who did not achieve HbA1c < 6.5% failed to normalize sLRP1 and ANP levels. There was an inverse correlation in the changes in sLRP1 and ANP (p = 0.031). The extent of sLRP1 changes over 12 months of metabolic control positively correlated with those of total cholesterol, LDL cholesterol, TG, TG/HDLc, and apolipoprotein B. CONCLUSIONS: Newly diagnosed T2DM patients have an increased sLRP1/ANP ratio, and increased sLRP1 and decreased ANP levels are normalized in the T2DM patients that reached an strict glycemic and metabolic control. sLRP1/ANP ratio could be a reliable marker of cardiometabolic function. Frontiers Media S.A. 2023-08-10 /pmc/articles/PMC10450024/ /pubmed/37635956 http://dx.doi.org/10.3389/fendo.2023.1236487 Text en Copyright © 2023 García, Gil, Miñambres, Benitez-Amaro, Rodríguez, Claudi, Julve, Benitez, Sánchez-Quesada, Rives, Garcia-Moll, Vilades, Perez and Llorente-Cortes https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Endocrinology
García, Eduardo
Gil, Pedro
Miñambres, Inka
Benitez-Amaro, Aleyda
Rodríguez, Claudia
Claudi, Lene
Julve, Josep
Benitez, Sonia
Sánchez-Quesada, Jose Luís
Rives, Jose
Garcia-Moll, Xavier
Vilades, David
Perez, Antonio
Llorente-Cortes, Vicenta
Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title_full Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title_fullStr Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title_full_unstemmed Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title_short Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
title_sort increased slrp1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed t2dm patients are normalized after optimization of glycemic control
topic Endocrinology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10450024/
https://www.ncbi.nlm.nih.gov/pubmed/37635956
http://dx.doi.org/10.3389/fendo.2023.1236487
work_keys_str_mv AT garciaeduardo increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT gilpedro increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT minambresinka increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT benitezamaroaleyda increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT rodriguezclaudia increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT claudilene increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT julvejosep increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT benitezsonia increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT sanchezquesadajoseluis increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT rivesjose increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT garciamollxavier increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT viladesdavid increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT perezantonio increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol
AT llorentecortesvicenta increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol