Cargando…
Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control
BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnose...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10450024/ https://www.ncbi.nlm.nih.gov/pubmed/37635956 http://dx.doi.org/10.3389/fendo.2023.1236487 |
_version_ | 1785095099856715776 |
---|---|
author | García, Eduardo Gil, Pedro Miñambres, Inka Benitez-Amaro, Aleyda Rodríguez, Claudia Claudi, Lene Julve, Josep Benitez, Sonia Sánchez-Quesada, Jose Luís Rives, Jose Garcia-Moll, Xavier Vilades, David Perez, Antonio Llorente-Cortes, Vicenta |
author_facet | García, Eduardo Gil, Pedro Miñambres, Inka Benitez-Amaro, Aleyda Rodríguez, Claudia Claudi, Lene Julve, Josep Benitez, Sonia Sánchez-Quesada, Jose Luís Rives, Jose Garcia-Moll, Xavier Vilades, David Perez, Antonio Llorente-Cortes, Vicenta |
author_sort | García, Eduardo |
collection | PubMed |
description | BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnosed type 2 diabetes mellitus (T2DM) and determine the effects of metabolic optimization. METHODS: This single-center longitudinal observational study recruited patients with newly diagnosed T2DM (n = 29, HbA1c > 8.5%), and 12 healthy control, age- and sex-matched volunteers. sLRP1 and ANP levels were measured by immunoassays at T2DM onset and at one year after optimization of glycemic control (HbA1c ≤ 6.5%). RESULTS: T2DM had higher sLRP1 levels than the control group (p = 0.014) and lower ANP levels (p =0.002). At 12 months, 23 T2DM patients reached the target of HbA1c ≤ 6.5%. These patients significantly reduced sLRP1 and increased ANP levels. Patients who did not achieve HbA1c < 6.5% failed to normalize sLRP1 and ANP levels. There was an inverse correlation in the changes in sLRP1 and ANP (p = 0.031). The extent of sLRP1 changes over 12 months of metabolic control positively correlated with those of total cholesterol, LDL cholesterol, TG, TG/HDLc, and apolipoprotein B. CONCLUSIONS: Newly diagnosed T2DM patients have an increased sLRP1/ANP ratio, and increased sLRP1 and decreased ANP levels are normalized in the T2DM patients that reached an strict glycemic and metabolic control. sLRP1/ANP ratio could be a reliable marker of cardiometabolic function. |
format | Online Article Text |
id | pubmed-10450024 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-104500242023-08-26 Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control García, Eduardo Gil, Pedro Miñambres, Inka Benitez-Amaro, Aleyda Rodríguez, Claudia Claudi, Lene Julve, Josep Benitez, Sonia Sánchez-Quesada, Jose Luís Rives, Jose Garcia-Moll, Xavier Vilades, David Perez, Antonio Llorente-Cortes, Vicenta Front Endocrinol (Lausanne) Endocrinology BACKGROUND: Low-density lipoprotein receptor-related protein 1 (LRP1) negatively modulates circulating atrial natriuretic peptide (ANP) levels. Both molecules are involved in the regulation of cardiometabolism. OBJECTIVES: To evaluate soluble LRP1 (sLRP1) and ANP levels in people with newly diagnosed type 2 diabetes mellitus (T2DM) and determine the effects of metabolic optimization. METHODS: This single-center longitudinal observational study recruited patients with newly diagnosed T2DM (n = 29, HbA1c > 8.5%), and 12 healthy control, age- and sex-matched volunteers. sLRP1 and ANP levels were measured by immunoassays at T2DM onset and at one year after optimization of glycemic control (HbA1c ≤ 6.5%). RESULTS: T2DM had higher sLRP1 levels than the control group (p = 0.014) and lower ANP levels (p =0.002). At 12 months, 23 T2DM patients reached the target of HbA1c ≤ 6.5%. These patients significantly reduced sLRP1 and increased ANP levels. Patients who did not achieve HbA1c < 6.5% failed to normalize sLRP1 and ANP levels. There was an inverse correlation in the changes in sLRP1 and ANP (p = 0.031). The extent of sLRP1 changes over 12 months of metabolic control positively correlated with those of total cholesterol, LDL cholesterol, TG, TG/HDLc, and apolipoprotein B. CONCLUSIONS: Newly diagnosed T2DM patients have an increased sLRP1/ANP ratio, and increased sLRP1 and decreased ANP levels are normalized in the T2DM patients that reached an strict glycemic and metabolic control. sLRP1/ANP ratio could be a reliable marker of cardiometabolic function. Frontiers Media S.A. 2023-08-10 /pmc/articles/PMC10450024/ /pubmed/37635956 http://dx.doi.org/10.3389/fendo.2023.1236487 Text en Copyright © 2023 García, Gil, Miñambres, Benitez-Amaro, Rodríguez, Claudi, Julve, Benitez, Sánchez-Quesada, Rives, Garcia-Moll, Vilades, Perez and Llorente-Cortes https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Endocrinology García, Eduardo Gil, Pedro Miñambres, Inka Benitez-Amaro, Aleyda Rodríguez, Claudia Claudi, Lene Julve, Josep Benitez, Sonia Sánchez-Quesada, Jose Luís Rives, Jose Garcia-Moll, Xavier Vilades, David Perez, Antonio Llorente-Cortes, Vicenta Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title | Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title_full | Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title_fullStr | Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title_full_unstemmed | Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title_short | Increased sLRP1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed T2DM patients are normalized after optimization of glycemic control |
title_sort | increased slrp1 and decreased atrial natriuretic peptide plasma levels in newly diagnosed t2dm patients are normalized after optimization of glycemic control |
topic | Endocrinology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10450024/ https://www.ncbi.nlm.nih.gov/pubmed/37635956 http://dx.doi.org/10.3389/fendo.2023.1236487 |
work_keys_str_mv | AT garciaeduardo increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT gilpedro increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT minambresinka increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT benitezamaroaleyda increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT rodriguezclaudia increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT claudilene increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT julvejosep increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT benitezsonia increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT sanchezquesadajoseluis increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT rivesjose increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT garciamollxavier increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT viladesdavid increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT perezantonio increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol AT llorentecortesvicenta increasedslrp1anddecreasedatrialnatriureticpeptideplasmalevelsinnewlydiagnosedt2dmpatientsarenormalizedafteroptimizationofglycemiccontrol |