Cargando…

Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study

BACKGROUND: Invisalign First System (First) is a new type of orthodontic appliance for maxillary arch expansion in mixed dentition children. Till now, few studies have evaluated the expansion effects of First versus other appliances. What’s more, most studies of arch expansion did not include a natu...

Descripción completa

Detalles Bibliográficos
Autores principales: Lu, Lanxin, Zhang, Lingling, Li, Chengri, Yi, Fang, Lei, Lei, Lu, Yanqin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10463527/
https://www.ncbi.nlm.nih.gov/pubmed/37635237
http://dx.doi.org/10.1186/s12903-023-03312-4
_version_ 1785098253471055872
author Lu, Lanxin
Zhang, Lingling
Li, Chengri
Yi, Fang
Lei, Lei
Lu, Yanqin
author_facet Lu, Lanxin
Zhang, Lingling
Li, Chengri
Yi, Fang
Lei, Lei
Lu, Yanqin
author_sort Lu, Lanxin
collection PubMed
description BACKGROUND: Invisalign First System (First) is a new type of orthodontic appliance for maxillary arch expansion in mixed dentition children. Till now, few studies have evaluated the expansion effects of First versus other appliances. What’s more, most studies of arch expansion did not include a natural group to rule out growth effects. This prospective cohort study aimed to evaluate the dental and dentoalveolar effects using First or acrylic splint rapid maxillary expander (RME) in adolescents excluding growth factors. MATERIALS AND METHODS: After screening by strict inclusion criteria and propensity score matching (PSM), fifty-one patients were included: First group (n = 17), RME group (n = 17), and natural growth (NG) group (n = 17). Nine indicators including dental arch width, dentoalveolar arch width, and inclination of the molars were measured on digital dental casts at baseline (T0) and six-month follow-up (T1). Paired t-tests were used for intra-group results, and two-sample independent t-tests were used for inter-group comparisons. RESULTS: There was no significant increase in all indicators within six months in the NG group (p > 0.05). In the First group and RME group, all width indicators were significantly increased after treatment (p < 0.05). The RME group exhibited greater expansion than the First group in intercanine width, first interpremolar width, second interdeciduous molar width, first intermolar width, arch perimeter, intercanine dentoalveolar width, intermolar dentoalveolar width, and inclination of the molars (p < 0.05). Whereas, there was no significant difference in arch depth between the two treated groups. CONCLUSIONS: Both First and RME can expand the maxillary arch in mixed dentition. In case of mild to moderate maxillary transverse deficiency (MTD), Invisalign First System could be a reasonable option. RME shows significant better efficiency of dental arch expansion than First, recommended for patients with severe MTD. TRIAL REGISTRATION: This prospective study was registered on ClinicalTrials.gov (01/02/2022, registration number: ChiCTR2200056220). The trial was approved by the Ethical Committee of the Hunan Xiangya Stomatological Hospital Central South University (20,200,088), and informed consent was obtained from all subjects and their legal guardian(s). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-023-03312-4.
format Online
Article
Text
id pubmed-10463527
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-104635272023-08-30 Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study Lu, Lanxin Zhang, Lingling Li, Chengri Yi, Fang Lei, Lei Lu, Yanqin BMC Oral Health Research BACKGROUND: Invisalign First System (First) is a new type of orthodontic appliance for maxillary arch expansion in mixed dentition children. Till now, few studies have evaluated the expansion effects of First versus other appliances. What’s more, most studies of arch expansion did not include a natural group to rule out growth effects. This prospective cohort study aimed to evaluate the dental and dentoalveolar effects using First or acrylic splint rapid maxillary expander (RME) in adolescents excluding growth factors. MATERIALS AND METHODS: After screening by strict inclusion criteria and propensity score matching (PSM), fifty-one patients were included: First group (n = 17), RME group (n = 17), and natural growth (NG) group (n = 17). Nine indicators including dental arch width, dentoalveolar arch width, and inclination of the molars were measured on digital dental casts at baseline (T0) and six-month follow-up (T1). Paired t-tests were used for intra-group results, and two-sample independent t-tests were used for inter-group comparisons. RESULTS: There was no significant increase in all indicators within six months in the NG group (p > 0.05). In the First group and RME group, all width indicators were significantly increased after treatment (p < 0.05). The RME group exhibited greater expansion than the First group in intercanine width, first interpremolar width, second interdeciduous molar width, first intermolar width, arch perimeter, intercanine dentoalveolar width, intermolar dentoalveolar width, and inclination of the molars (p < 0.05). Whereas, there was no significant difference in arch depth between the two treated groups. CONCLUSIONS: Both First and RME can expand the maxillary arch in mixed dentition. In case of mild to moderate maxillary transverse deficiency (MTD), Invisalign First System could be a reasonable option. RME shows significant better efficiency of dental arch expansion than First, recommended for patients with severe MTD. TRIAL REGISTRATION: This prospective study was registered on ClinicalTrials.gov (01/02/2022, registration number: ChiCTR2200056220). The trial was approved by the Ethical Committee of the Hunan Xiangya Stomatological Hospital Central South University (20,200,088), and informed consent was obtained from all subjects and their legal guardian(s). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-023-03312-4. BioMed Central 2023-08-27 /pmc/articles/PMC10463527/ /pubmed/37635237 http://dx.doi.org/10.1186/s12903-023-03312-4 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Lu, Lanxin
Zhang, Lingling
Li, Chengri
Yi, Fang
Lei, Lei
Lu, Yanqin
Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title_full Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title_fullStr Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title_full_unstemmed Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title_short Treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
title_sort treatment effects after maxillary expansion using invisalign first system vs. acrylic splint expander in mixed dentition: a prospective cohort study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10463527/
https://www.ncbi.nlm.nih.gov/pubmed/37635237
http://dx.doi.org/10.1186/s12903-023-03312-4
work_keys_str_mv AT lulanxin treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy
AT zhanglingling treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy
AT lichengri treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy
AT yifang treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy
AT leilei treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy
AT luyanqin treatmenteffectsaftermaxillaryexpansionusinginvisalignfirstsystemvsacrylicsplintexpanderinmixeddentitionaprospectivecohortstudy