Cargando…
High-intensity walking in midlife is associated with improved memory in physically capable older adults
BACKGROUND: Little is known about the associations of midlife- and late life-initiated walking with Alzheimer’s disease (AD)-related cognitive decline in humans. We aimed to investigate whether high-intensity, prolonged, midlife-initiated walking is associated with changes in AD-related cognitive de...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10463890/ https://www.ncbi.nlm.nih.gov/pubmed/37644550 http://dx.doi.org/10.1186/s13195-023-01293-8 |
_version_ | 1785098338058633216 |
---|---|
author | Choe, Young Min Suh, Guk-Hee Lee, Boung Chul Choi, Ihn-Geun Kim, Hyun Soo Kim, Jong Wan Hwang, Jaeuk Yi, Dahyun Kim, Jee Wook |
author_facet | Choe, Young Min Suh, Guk-Hee Lee, Boung Chul Choi, Ihn-Geun Kim, Hyun Soo Kim, Jong Wan Hwang, Jaeuk Yi, Dahyun Kim, Jee Wook |
author_sort | Choe, Young Min |
collection | PubMed |
description | BACKGROUND: Little is known about the associations of midlife- and late life-initiated walking with Alzheimer’s disease (AD)-related cognitive decline in humans. We aimed to investigate whether high-intensity, prolonged, midlife-initiated walking is associated with changes in AD-related cognitive decline in physically capable older adults. METHODS: We studied 188 physically capable participants aged 65–90 years without dementia who underwent comprehensive clinical assessment, including of their walking modality (i.e., intensity, duration, midlife- or late life-onset), memory- or non-memory and total cognitive performance, and blood or nutritional biomarkers. RESULTS: The walking group showed better episodic memory (B = 2.852, SE = 1.214, β = 0.144, p = 0.020), but not non-memory cognition, than the non-walking group. High-intensity walking starting in midlife was significantly associated with better episodic memory (B = 9.360, SE = 3.314, β = 0.446, p = 0.005) compared to the non-walking group. In contrast, there were no differences in cognition according to walking duration, regardless of the onset time. The walking group also showed a similar association with overall cognition. CONCLUSIONS: Among physically capable older adults without dementia, walking, particularly at high intensity and starting in midlife, is associated with improved episodic memory, an AD-related cognitive domain. Further attention should be paid to the role of walking in terms of AD prevention. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13195-023-01293-8. |
format | Online Article Text |
id | pubmed-10463890 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-104638902023-08-30 High-intensity walking in midlife is associated with improved memory in physically capable older adults Choe, Young Min Suh, Guk-Hee Lee, Boung Chul Choi, Ihn-Geun Kim, Hyun Soo Kim, Jong Wan Hwang, Jaeuk Yi, Dahyun Kim, Jee Wook Alzheimers Res Ther Research BACKGROUND: Little is known about the associations of midlife- and late life-initiated walking with Alzheimer’s disease (AD)-related cognitive decline in humans. We aimed to investigate whether high-intensity, prolonged, midlife-initiated walking is associated with changes in AD-related cognitive decline in physically capable older adults. METHODS: We studied 188 physically capable participants aged 65–90 years without dementia who underwent comprehensive clinical assessment, including of their walking modality (i.e., intensity, duration, midlife- or late life-onset), memory- or non-memory and total cognitive performance, and blood or nutritional biomarkers. RESULTS: The walking group showed better episodic memory (B = 2.852, SE = 1.214, β = 0.144, p = 0.020), but not non-memory cognition, than the non-walking group. High-intensity walking starting in midlife was significantly associated with better episodic memory (B = 9.360, SE = 3.314, β = 0.446, p = 0.005) compared to the non-walking group. In contrast, there were no differences in cognition according to walking duration, regardless of the onset time. The walking group also showed a similar association with overall cognition. CONCLUSIONS: Among physically capable older adults without dementia, walking, particularly at high intensity and starting in midlife, is associated with improved episodic memory, an AD-related cognitive domain. Further attention should be paid to the role of walking in terms of AD prevention. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13195-023-01293-8. BioMed Central 2023-08-29 /pmc/articles/PMC10463890/ /pubmed/37644550 http://dx.doi.org/10.1186/s13195-023-01293-8 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Choe, Young Min Suh, Guk-Hee Lee, Boung Chul Choi, Ihn-Geun Kim, Hyun Soo Kim, Jong Wan Hwang, Jaeuk Yi, Dahyun Kim, Jee Wook High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title | High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title_full | High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title_fullStr | High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title_full_unstemmed | High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title_short | High-intensity walking in midlife is associated with improved memory in physically capable older adults |
title_sort | high-intensity walking in midlife is associated with improved memory in physically capable older adults |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10463890/ https://www.ncbi.nlm.nih.gov/pubmed/37644550 http://dx.doi.org/10.1186/s13195-023-01293-8 |
work_keys_str_mv | AT choeyoungmin highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT suhgukhee highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT leeboungchul highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT choiihngeun highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT kimhyunsoo highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT kimjongwan highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT hwangjaeuk highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT yidahyun highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults AT kimjeewook highintensitywalkinginmidlifeisassociatedwithimprovedmemoryinphysicallycapableolderadults |