Cargando…

Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells

BACKGROUND: Nutrition has not only an impact on the general wellbeing of an animal but can also affect reproductive processes. In cattle, feeding regimes can influence the age of puberty onset and alter gonadal development. We analyzed effects of different milk replacer (MR) feeding regimes during r...

Descripción completa

Detalles Bibliográficos
Autores principales: Röttgen, Volker, Tümmler, Lisa-Maria, Koczan, Dirk, Rebl, Alexander, Kuhla, Björn, Vanselow, Jens, Baufeld, Anja
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10464335/
https://www.ncbi.nlm.nih.gov/pubmed/37626314
http://dx.doi.org/10.1186/s12864-023-09589-7
_version_ 1785098446086078464
author Röttgen, Volker
Tümmler, Lisa-Maria
Koczan, Dirk
Rebl, Alexander
Kuhla, Björn
Vanselow, Jens
Baufeld, Anja
author_facet Röttgen, Volker
Tümmler, Lisa-Maria
Koczan, Dirk
Rebl, Alexander
Kuhla, Björn
Vanselow, Jens
Baufeld, Anja
author_sort Röttgen, Volker
collection PubMed
description BACKGROUND: Nutrition has not only an impact on the general wellbeing of an animal but can also affect reproductive processes. In cattle, feeding regimes can influence the age of puberty onset and alter gonadal development. We analyzed effects of different milk replacer (MR) feeding regimes during rearing on ovarian physiology with specific emphasis on the numbers as well as gene expression characteristics of granulosa cells (GCs) at the age of puberty onset. Two groups of calves received either 10% or 20% of bodyweight MR per day during their first 8 weeks. After weaning, both groups were fed the same mixed ration ad libitum until slaughter at 8 months. RESULTS: Animals of the 20% feeding group had a significantly higher body weight, but the proportion of animals having a corpus luteum at the time of slaughter was not different between groups, suggesting a similar onset of puberty. Calves of the 10% group showed a constant GC count regardless of the number of follicles (r = 0.23) whereas in the 20% group increasing numbers of GCs were detected with a higher follicle count (r = 0.71). As a first effort to find a possible molecular explanation for this unexpected limitation of GC numbers in the 10% group, we comparatively analyzed GC transcriptomes in both diet groups. The mRNA microarray analysis revealed a total of 557 differentially expressed genes comparing both groups (fold change > |1.5| and p < 0.05). OAS1X, MX2 and OAS1Z were among the top downregulated genes in the 20% vs. the 10% group, whereas top upregulated genes comprised BOLA and XCL1. All of these genes are known to be regulated by interferon. Subsequent signaling pathway analysis revealed the involvement of several immune response mechanisms in accordance with a number of interferons as upstream regulators. CONCLUSIONS: The results indicate that the plane of MR feeding in early life has an impact on the number and physiology of GCs later in life. This might influence the overall reproductive life initiated by the onset of puberty in cattle. In addition, the observed alterations in GCs of calves fed less MR might be a consequence of interferon regulated immunological pathways. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12864-023-09589-7.
format Online
Article
Text
id pubmed-10464335
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-104643352023-08-30 Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells Röttgen, Volker Tümmler, Lisa-Maria Koczan, Dirk Rebl, Alexander Kuhla, Björn Vanselow, Jens Baufeld, Anja BMC Genomics Research BACKGROUND: Nutrition has not only an impact on the general wellbeing of an animal but can also affect reproductive processes. In cattle, feeding regimes can influence the age of puberty onset and alter gonadal development. We analyzed effects of different milk replacer (MR) feeding regimes during rearing on ovarian physiology with specific emphasis on the numbers as well as gene expression characteristics of granulosa cells (GCs) at the age of puberty onset. Two groups of calves received either 10% or 20% of bodyweight MR per day during their first 8 weeks. After weaning, both groups were fed the same mixed ration ad libitum until slaughter at 8 months. RESULTS: Animals of the 20% feeding group had a significantly higher body weight, but the proportion of animals having a corpus luteum at the time of slaughter was not different between groups, suggesting a similar onset of puberty. Calves of the 10% group showed a constant GC count regardless of the number of follicles (r = 0.23) whereas in the 20% group increasing numbers of GCs were detected with a higher follicle count (r = 0.71). As a first effort to find a possible molecular explanation for this unexpected limitation of GC numbers in the 10% group, we comparatively analyzed GC transcriptomes in both diet groups. The mRNA microarray analysis revealed a total of 557 differentially expressed genes comparing both groups (fold change > |1.5| and p < 0.05). OAS1X, MX2 and OAS1Z were among the top downregulated genes in the 20% vs. the 10% group, whereas top upregulated genes comprised BOLA and XCL1. All of these genes are known to be regulated by interferon. Subsequent signaling pathway analysis revealed the involvement of several immune response mechanisms in accordance with a number of interferons as upstream regulators. CONCLUSIONS: The results indicate that the plane of MR feeding in early life has an impact on the number and physiology of GCs later in life. This might influence the overall reproductive life initiated by the onset of puberty in cattle. In addition, the observed alterations in GCs of calves fed less MR might be a consequence of interferon regulated immunological pathways. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12864-023-09589-7. BioMed Central 2023-08-25 /pmc/articles/PMC10464335/ /pubmed/37626314 http://dx.doi.org/10.1186/s12864-023-09589-7 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Röttgen, Volker
Tümmler, Lisa-Maria
Koczan, Dirk
Rebl, Alexander
Kuhla, Björn
Vanselow, Jens
Baufeld, Anja
Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title_full Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title_fullStr Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title_full_unstemmed Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title_short Early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
title_sort early milk-feeding regimes in calves exert long-term effects on the development of ovarian granulosa cells
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10464335/
https://www.ncbi.nlm.nih.gov/pubmed/37626314
http://dx.doi.org/10.1186/s12864-023-09589-7
work_keys_str_mv AT rottgenvolker earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT tummlerlisamaria earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT koczandirk earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT reblalexander earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT kuhlabjorn earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT vanselowjens earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells
AT baufeldanja earlymilkfeedingregimesincalvesexertlongtermeffectsonthedevelopmentofovariangranulosacells