Cargando…
A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibili...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer - Medknow
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10470566/ https://www.ncbi.nlm.nih.gov/pubmed/37662134 http://dx.doi.org/10.4103/ijcm.ijcm_486_22 |
_version_ | 1785099707245133824 |
---|---|
author | Kannadasan, Anand Babu Sumantran, Venil Naranan Vaidyanathan, Rama |
author_facet | Kannadasan, Anand Babu Sumantran, Venil Naranan Vaidyanathan, Rama |
author_sort | Kannadasan, Anand Babu |
collection | PubMed |
description | BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibility in Klebsiella pneumoniae. Here, our objective was to study the diversity of CRISPR-Cas system in the genome of K. pneumoniae from the available whole genome sequencing (WGS) data. MATERIAL AND METHODS: We identified the CRISPR-Cas systems of K. pneumoniae using the CRISPR-CasFinder database. The complete genome sequence and its submission details were obtained from the National Center for Biotechnology Information (NCBI) database. RESULTS: A total of 1607 K. pneumoniae whole genome sequences were analyzed. The major contributors of WGS data of K. pneumoniae were China (26.6%), United States (21.5%), Australia (10%), South Korea (8%), India (5.5%), and United Kingdom (4.9%). Out of 1607 genomes analyzed, almost one-fourth were CRISPR-Cas positive (403/1607) and three-fourth were CRISPR-Cas negative (1204/1607). Among CRISPR-Cas positive strains, 220 belonged to type I-E* and 183 were type I-E. Furthermore, type I-E* CRISPR-Cas systems were significantly higher in Asia (P < 0.001), whereas type I-E were significantly higher in Europe (P < 0.01). Among countries, typically, type I-E* strains were found to be higher in China (P < 0.01) and India (P < 0.01), whereas type I-E strains were higher in Germany (P < 0.01). CONCLUSION: Hence, it is important to know the type of CRISPR-Cas systems in K. pneumoniae strains across the countries and it can help to understand the diversity of CRISPR-Cas systems worldwide. |
format | Online Article Text |
id | pubmed-10470566 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Wolters Kluwer - Medknow |
record_format | MEDLINE/PubMed |
spelling | pubmed-104705662023-09-01 A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae Kannadasan, Anand Babu Sumantran, Venil Naranan Vaidyanathan, Rama Indian J Community Med Original Article BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibility in Klebsiella pneumoniae. Here, our objective was to study the diversity of CRISPR-Cas system in the genome of K. pneumoniae from the available whole genome sequencing (WGS) data. MATERIAL AND METHODS: We identified the CRISPR-Cas systems of K. pneumoniae using the CRISPR-CasFinder database. The complete genome sequence and its submission details were obtained from the National Center for Biotechnology Information (NCBI) database. RESULTS: A total of 1607 K. pneumoniae whole genome sequences were analyzed. The major contributors of WGS data of K. pneumoniae were China (26.6%), United States (21.5%), Australia (10%), South Korea (8%), India (5.5%), and United Kingdom (4.9%). Out of 1607 genomes analyzed, almost one-fourth were CRISPR-Cas positive (403/1607) and three-fourth were CRISPR-Cas negative (1204/1607). Among CRISPR-Cas positive strains, 220 belonged to type I-E* and 183 were type I-E. Furthermore, type I-E* CRISPR-Cas systems were significantly higher in Asia (P < 0.001), whereas type I-E were significantly higher in Europe (P < 0.01). Among countries, typically, type I-E* strains were found to be higher in China (P < 0.01) and India (P < 0.01), whereas type I-E strains were higher in Germany (P < 0.01). CONCLUSION: Hence, it is important to know the type of CRISPR-Cas systems in K. pneumoniae strains across the countries and it can help to understand the diversity of CRISPR-Cas systems worldwide. Wolters Kluwer - Medknow 2023 2023-07-14 /pmc/articles/PMC10470566/ /pubmed/37662134 http://dx.doi.org/10.4103/ijcm.ijcm_486_22 Text en Copyright: © 2023 Indian Journal of Community Medicine https://creativecommons.org/licenses/by-nc-sa/4.0/This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms. |
spellingShingle | Original Article Kannadasan, Anand Babu Sumantran, Venil Naranan Vaidyanathan, Rama A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title | A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title_full | A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title_fullStr | A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title_full_unstemmed | A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title_short | A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae |
title_sort | global comprehensive study of the distribution of type i-e and type i-e* crispr-cas systems in klebsiella pneumoniae |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10470566/ https://www.ncbi.nlm.nih.gov/pubmed/37662134 http://dx.doi.org/10.4103/ijcm.ijcm_486_22 |
work_keys_str_mv | AT kannadasananandbabu aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae AT sumantranvenilnaranan aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae AT vaidyanathanrama aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae AT kannadasananandbabu globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae AT sumantranvenilnaranan globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae AT vaidyanathanrama globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae |