Cargando…

A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae

BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibili...

Descripción completa

Detalles Bibliográficos
Autores principales: Kannadasan, Anand Babu, Sumantran, Venil Naranan, Vaidyanathan, Rama
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Wolters Kluwer - Medknow 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10470566/
https://www.ncbi.nlm.nih.gov/pubmed/37662134
http://dx.doi.org/10.4103/ijcm.ijcm_486_22
_version_ 1785099707245133824
author Kannadasan, Anand Babu
Sumantran, Venil Naranan
Vaidyanathan, Rama
author_facet Kannadasan, Anand Babu
Sumantran, Venil Naranan
Vaidyanathan, Rama
author_sort Kannadasan, Anand Babu
collection PubMed
description BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibility in Klebsiella pneumoniae. Here, our objective was to study the diversity of CRISPR-Cas system in the genome of K. pneumoniae from the available whole genome sequencing (WGS) data. MATERIAL AND METHODS: We identified the CRISPR-Cas systems of K. pneumoniae using the CRISPR-CasFinder database. The complete genome sequence and its submission details were obtained from the National Center for Biotechnology Information (NCBI) database. RESULTS: A total of 1607 K. pneumoniae whole genome sequences were analyzed. The major contributors of WGS data of K. pneumoniae were China (26.6%), United States (21.5%), Australia (10%), South Korea (8%), India (5.5%), and United Kingdom (4.9%). Out of 1607 genomes analyzed, almost one-fourth were CRISPR-Cas positive (403/1607) and three-fourth were CRISPR-Cas negative (1204/1607). Among CRISPR-Cas positive strains, 220 belonged to type I-E* and 183 were type I-E. Furthermore, type I-E* CRISPR-Cas systems were significantly higher in Asia (P < 0.001), whereas type I-E were significantly higher in Europe (P < 0.01). Among countries, typically, type I-E* strains were found to be higher in China (P < 0.01) and India (P < 0.01), whereas type I-E strains were higher in Germany (P < 0.01). CONCLUSION: Hence, it is important to know the type of CRISPR-Cas systems in K. pneumoniae strains across the countries and it can help to understand the diversity of CRISPR-Cas systems worldwide.
format Online
Article
Text
id pubmed-10470566
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Wolters Kluwer - Medknow
record_format MEDLINE/PubMed
spelling pubmed-104705662023-09-01 A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae Kannadasan, Anand Babu Sumantran, Venil Naranan Vaidyanathan, Rama Indian J Community Med Original Article BACKGROUND: The CRISPR-Cas (clustered regularly interspaced short palindromic repeats–CRISPR-associated proteins) systems are the short DNA sequences and RNA-dependent nuclease involved in the adaptive immunity in bacteria and archaea. The type of CRISPR-Cas system influences antibiotic susceptibility in Klebsiella pneumoniae. Here, our objective was to study the diversity of CRISPR-Cas system in the genome of K. pneumoniae from the available whole genome sequencing (WGS) data. MATERIAL AND METHODS: We identified the CRISPR-Cas systems of K. pneumoniae using the CRISPR-CasFinder database. The complete genome sequence and its submission details were obtained from the National Center for Biotechnology Information (NCBI) database. RESULTS: A total of 1607 K. pneumoniae whole genome sequences were analyzed. The major contributors of WGS data of K. pneumoniae were China (26.6%), United States (21.5%), Australia (10%), South Korea (8%), India (5.5%), and United Kingdom (4.9%). Out of 1607 genomes analyzed, almost one-fourth were CRISPR-Cas positive (403/1607) and three-fourth were CRISPR-Cas negative (1204/1607). Among CRISPR-Cas positive strains, 220 belonged to type I-E* and 183 were type I-E. Furthermore, type I-E* CRISPR-Cas systems were significantly higher in Asia (P < 0.001), whereas type I-E were significantly higher in Europe (P < 0.01). Among countries, typically, type I-E* strains were found to be higher in China (P < 0.01) and India (P < 0.01), whereas type I-E strains were higher in Germany (P < 0.01). CONCLUSION: Hence, it is important to know the type of CRISPR-Cas systems in K. pneumoniae strains across the countries and it can help to understand the diversity of CRISPR-Cas systems worldwide. Wolters Kluwer - Medknow 2023 2023-07-14 /pmc/articles/PMC10470566/ /pubmed/37662134 http://dx.doi.org/10.4103/ijcm.ijcm_486_22 Text en Copyright: © 2023 Indian Journal of Community Medicine https://creativecommons.org/licenses/by-nc-sa/4.0/This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms.
spellingShingle Original Article
Kannadasan, Anand Babu
Sumantran, Venil Naranan
Vaidyanathan, Rama
A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title_full A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title_fullStr A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title_full_unstemmed A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title_short A Global Comprehensive Study of the Distribution of Type I-E and Type I-E* CRISPR-Cas Systems in Klebsiella pneumoniae
title_sort global comprehensive study of the distribution of type i-e and type i-e* crispr-cas systems in klebsiella pneumoniae
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10470566/
https://www.ncbi.nlm.nih.gov/pubmed/37662134
http://dx.doi.org/10.4103/ijcm.ijcm_486_22
work_keys_str_mv AT kannadasananandbabu aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae
AT sumantranvenilnaranan aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae
AT vaidyanathanrama aglobalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae
AT kannadasananandbabu globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae
AT sumantranvenilnaranan globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae
AT vaidyanathanrama globalcomprehensivestudyofthedistributionoftypeieandtypeiecrisprcassystemsinklebsiellapneumoniae