Cargando…

Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study

BACKGROUND: Numerous studies have shown that the dietary inflammatory index (DII) is associated with adverse health effects. However, the relationship between DII and prostate cancer (PCa) remains controversial. Although alcohol is included in DII as a dietary factor, the various adverse health effe...

Descripción completa

Detalles Bibliográficos
Autores principales: Weng, Xiangtao, Tan, Wenyue, Wei, Baian, Yang, Shijian, Gu, Chiming, Wang, Shusheng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10478225/
https://www.ncbi.nlm.nih.gov/pubmed/37670257
http://dx.doi.org/10.1186/s12877-023-04151-2
_version_ 1785101300674854912
author Weng, Xiangtao
Tan, Wenyue
Wei, Baian
Yang, Shijian
Gu, Chiming
Wang, Shusheng
author_facet Weng, Xiangtao
Tan, Wenyue
Wei, Baian
Yang, Shijian
Gu, Chiming
Wang, Shusheng
author_sort Weng, Xiangtao
collection PubMed
description BACKGROUND: Numerous studies have shown that the dietary inflammatory index (DII) is associated with adverse health effects. However, the relationship between DII and prostate cancer (PCa) remains controversial. Although alcohol is included in DII as a dietary factor, the various adverse health effects of alcohol consumption are not only related to inflammation. On the other hand, it has been a long-standing debate whether alcohol consumption is linked to the risk of PCa. Therefore, to clarify whether drinking affects the relationship between DII and PCa, we evaluated the correlation between DII and prostate-specific antigen (PSA) based on the National Health and Nutrition Examination Survey (NHANES) database. METHODS: We used data from the NHANES spanning from 2005 to 2010 to analyze the relationship between PCa and DII. Out of the 31,034 NHANES participants, we enrolled 4,120 individuals in our study, utilizing dietary intake data from a twenty-four-hour period to determine DII scores. Demographic data, physical and laboratory test results were collected to compare between low PSA and high PSA groups, and to calculate the odds ratio between both groups, we employed a logistic regression analysis. RESULTS: In this cross-sectional investigation of PCa, drinkers and non-drinkers had different relationships between DII and PSA levels (OR: 1.2, 95% Cl: 1-1.44 vs. OR: 0.98, 95% Cl: 0.9–1.07), and DII and abstaining from alcohol were effective in reducing the incidence of PSA (p-value for significant interaction = 0.037). CONCLUSION: The results of our study suggest that drinking may influence the relationship between DII and PSA levels. DII is likely to be a reliable indicator for estimating PSA levels among non-drinkers, who may limit their intake of pro-inflammatory ingredients to lower the incidence and death of PCa. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12877-023-04151-2.
format Online
Article
Text
id pubmed-10478225
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-104782252023-09-06 Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study Weng, Xiangtao Tan, Wenyue Wei, Baian Yang, Shijian Gu, Chiming Wang, Shusheng BMC Geriatr Research BACKGROUND: Numerous studies have shown that the dietary inflammatory index (DII) is associated with adverse health effects. However, the relationship between DII and prostate cancer (PCa) remains controversial. Although alcohol is included in DII as a dietary factor, the various adverse health effects of alcohol consumption are not only related to inflammation. On the other hand, it has been a long-standing debate whether alcohol consumption is linked to the risk of PCa. Therefore, to clarify whether drinking affects the relationship between DII and PCa, we evaluated the correlation between DII and prostate-specific antigen (PSA) based on the National Health and Nutrition Examination Survey (NHANES) database. METHODS: We used data from the NHANES spanning from 2005 to 2010 to analyze the relationship between PCa and DII. Out of the 31,034 NHANES participants, we enrolled 4,120 individuals in our study, utilizing dietary intake data from a twenty-four-hour period to determine DII scores. Demographic data, physical and laboratory test results were collected to compare between low PSA and high PSA groups, and to calculate the odds ratio between both groups, we employed a logistic regression analysis. RESULTS: In this cross-sectional investigation of PCa, drinkers and non-drinkers had different relationships between DII and PSA levels (OR: 1.2, 95% Cl: 1-1.44 vs. OR: 0.98, 95% Cl: 0.9–1.07), and DII and abstaining from alcohol were effective in reducing the incidence of PSA (p-value for significant interaction = 0.037). CONCLUSION: The results of our study suggest that drinking may influence the relationship between DII and PSA levels. DII is likely to be a reliable indicator for estimating PSA levels among non-drinkers, who may limit their intake of pro-inflammatory ingredients to lower the incidence and death of PCa. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12877-023-04151-2. BioMed Central 2023-09-05 /pmc/articles/PMC10478225/ /pubmed/37670257 http://dx.doi.org/10.1186/s12877-023-04151-2 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Weng, Xiangtao
Tan, Wenyue
Wei, Baian
Yang, Shijian
Gu, Chiming
Wang, Shusheng
Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title_full Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title_fullStr Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title_full_unstemmed Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title_short Interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
title_sort interaction between drinking and dietary inflammatory index affects prostate specific antigen: a cross-sectional study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10478225/
https://www.ncbi.nlm.nih.gov/pubmed/37670257
http://dx.doi.org/10.1186/s12877-023-04151-2
work_keys_str_mv AT wengxiangtao interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy
AT tanwenyue interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy
AT weibaian interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy
AT yangshijian interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy
AT guchiming interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy
AT wangshusheng interactionbetweendrinkinganddietaryinflammatoryindexaffectsprostatespecificantigenacrosssectionalstudy