Cargando…

Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review

INTRODUCTION: Schizophrenia (SCZ) is a chronic mental illness characterized by a rich and diverse symptomatology. A generalized cognitive deficit has been widely recognized among the symptoms of this disease. Several authors have studied the relationship between peripheral markers of inflammation an...

Descripción completa

Detalles Bibliográficos
Autores principales: Ben Othman, F., Aissa, A., Adouni, A., Yosra, Z., Ouali, U., Jomli, R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cambridge University Press 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10479217/
http://dx.doi.org/10.1192/j.eurpsy.2023.2241
_version_ 1785101529830653952
author Ben Othman, F.
Aissa, A.
Adouni, A.
Yosra, Z.
Ouali, U.
Jomli, R.
author_facet Ben Othman, F.
Aissa, A.
Adouni, A.
Yosra, Z.
Ouali, U.
Jomli, R.
author_sort Ben Othman, F.
collection PubMed
description INTRODUCTION: Schizophrenia (SCZ) is a chronic mental illness characterized by a rich and diverse symptomatology. A generalized cognitive deficit has been widely recognized among the symptoms of this disease. Several authors have studied the relationship between peripheral markers of inflammation and cognitive dysfunctions in order to explain the etiopathogeny of these disorders. OBJECTIVES: The aim of our study is to better comprehend the nature of the relation between peripheral markers of inflammation and cognitive dysfunctions. METHODS: A systematic review of the literature was conducted following the guidelines provided by the PRISMA method. We performed a systematic search focused on two automated bibliographic databases: Pubmed and Google Scholar including the following keywords: “inflammation”, “schizophrenia”, “cognition” RESULTS: A total of 17 articles were included. Significant relations with cognitive function were reported with IL-6, IL-18, IL-2, IL-8, tumor necrosis factor α (TNF-α ) and chemokines. Memory was the cognitive domain where the most significant relations with cytokines were objectified. BDNF levels were correlated with cognitive tests in 5 studies of SCZ populations. The domains concerned were inhibition, flexibility, verbal fluency, verbal memory, attention, and processing speed. Elevated CRP in patients with SCZ was reported by all studies and a significant relation with cognition in 3 studies. This relations is objectified in the areas of memory, executive functions and processing speed. The relations between CRP, BDNF, cytokines and cognitive functions was inconsistent across studies. CONCLUSIONS: The majority of the results observed during the review were in favor of a significant relation between CRP, BDNF and cytokines. Nevertheless, these results were not constant and heterogeneous. It would be interesting to better explore the nature of this relation through prospective studies in order to establish therapeutic perspectives. DISCLOSURE OF INTEREST: None Declared
format Online
Article
Text
id pubmed-10479217
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Cambridge University Press
record_format MEDLINE/PubMed
spelling pubmed-104792172023-09-06 Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review Ben Othman, F. Aissa, A. Adouni, A. Yosra, Z. Ouali, U. Jomli, R. Eur Psychiatry Abstract INTRODUCTION: Schizophrenia (SCZ) is a chronic mental illness characterized by a rich and diverse symptomatology. A generalized cognitive deficit has been widely recognized among the symptoms of this disease. Several authors have studied the relationship between peripheral markers of inflammation and cognitive dysfunctions in order to explain the etiopathogeny of these disorders. OBJECTIVES: The aim of our study is to better comprehend the nature of the relation between peripheral markers of inflammation and cognitive dysfunctions. METHODS: A systematic review of the literature was conducted following the guidelines provided by the PRISMA method. We performed a systematic search focused on two automated bibliographic databases: Pubmed and Google Scholar including the following keywords: “inflammation”, “schizophrenia”, “cognition” RESULTS: A total of 17 articles were included. Significant relations with cognitive function were reported with IL-6, IL-18, IL-2, IL-8, tumor necrosis factor α (TNF-α ) and chemokines. Memory was the cognitive domain where the most significant relations with cytokines were objectified. BDNF levels were correlated with cognitive tests in 5 studies of SCZ populations. The domains concerned were inhibition, flexibility, verbal fluency, verbal memory, attention, and processing speed. Elevated CRP in patients with SCZ was reported by all studies and a significant relation with cognition in 3 studies. This relations is objectified in the areas of memory, executive functions and processing speed. The relations between CRP, BDNF, cytokines and cognitive functions was inconsistent across studies. CONCLUSIONS: The majority of the results observed during the review were in favor of a significant relation between CRP, BDNF and cytokines. Nevertheless, these results were not constant and heterogeneous. It would be interesting to better explore the nature of this relation through prospective studies in order to establish therapeutic perspectives. DISCLOSURE OF INTEREST: None Declared Cambridge University Press 2023-07-19 /pmc/articles/PMC10479217/ http://dx.doi.org/10.1192/j.eurpsy.2023.2241 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/This is an Open Access article, distributed under the terms of the Creative Commons Attribution licence (https://creativecommons.org/licenses/by/4.0/), which permits unrestricted re-use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Abstract
Ben Othman, F.
Aissa, A.
Adouni, A.
Yosra, Z.
Ouali, U.
Jomli, R.
Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title_full Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title_fullStr Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title_full_unstemmed Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title_short Role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
title_sort role of peripheral markers of inflammation in cognitive dysfunction in schizophrenic patients: a systematic review
topic Abstract
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10479217/
http://dx.doi.org/10.1192/j.eurpsy.2023.2241
work_keys_str_mv AT benothmanf roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview
AT aissaa roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview
AT adounia roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview
AT yosraz roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview
AT oualiu roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview
AT jomlir roleofperipheralmarkersofinflammationincognitivedysfunctioninschizophrenicpatientsasystematicreview