Cargando…

Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats

BACKGROUND: Rheumatoid arthritis (RA) is a chronic autoimmune disorder characterized by symmetric arthritis. Coix Seed Oil (CSO) has been shown to reduce inflammation in collagen induced arthritis (CIA) rats. However, the effect of CSO on synovial angiogenesis in RA is unknown. In this study, we aim...

Descripción completa

Detalles Bibliográficos
Autores principales: Xu, Qiangqiang, Kong, Hongxi, Ren, Shuang, Meng, Fanyan, Liu, Ruoshi, Jin, Hongxin, Zhang, Jie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10504826/
https://www.ncbi.nlm.nih.gov/pubmed/37715217
http://dx.doi.org/10.1186/s13020-023-00833-6
_version_ 1785106812947660800
author Xu, Qiangqiang
Kong, Hongxi
Ren, Shuang
Meng, Fanyan
Liu, Ruoshi
Jin, Hongxin
Zhang, Jie
author_facet Xu, Qiangqiang
Kong, Hongxi
Ren, Shuang
Meng, Fanyan
Liu, Ruoshi
Jin, Hongxin
Zhang, Jie
author_sort Xu, Qiangqiang
collection PubMed
description BACKGROUND: Rheumatoid arthritis (RA) is a chronic autoimmune disorder characterized by symmetric arthritis. Coix Seed Oil (CSO) has been shown to reduce inflammation in collagen induced arthritis (CIA) rats. However, the effect of CSO on synovial angiogenesis in RA is unknown. In this study, we aimed to explore whether CSO could inhibit RA synovial angiogenesis and elucidate the underlying mechanisms. METHODS: CIA rat models were established and subjected to different doses of CSO treatments for four weeks in vivo. Arthritis index, paw swelling, and weight were recorded to assess clinical symptoms. Hematoxylin and Eosin staining, Safarnin O fast green staining, Micro-CT, Immunohistochemical, and Immunofluorescence (IF) staining were performed to examined changes in synovial and joint tissues. The serum HIF-1α and VEGF-A levels were evaluated through enzyme-linked immunosorbent assay. Fibroblast-like synoviocytes (FLS) of rats was stimulated with tumor necrosis factor-α (TNF-α) for developing inflammatory model in vitro. Optimal concentrations of CSO and TNF-α for stimulation were measured through Cell Counting Kit-8 test. Wound healing and Transwell migration experiments were employed to determine FLS migratory ability. IF staining was performed to assess HIF-1α nuclear translocation in FLS. Protein levels of SIRT1, HIF-1α, VEGF-A, and CD31 were assessed through Western blot. The isolated aortic rings were induced with recombinant rat VEGF-A 165 (VEGF-A(165)) to observe the CSO inhibitory impact on angiogenesis ex vivo. RESULTS: CSO attenuated the progression of arthritis in CIA rats, mitigated histopathological deterioration in synovial and joint tissues, significantly inhibited immature vessels labeled with CD31(+)/αSMA(−), and reduced the micro-vessels in VEGF-A(165) induced aortic rings. Moreover, it upregulated SIRT1 protein levels in CIA rats and TNF-α induced FLS, but decreased HIF-1α and VEGF-A protein levels. Furthermore, CSO inhibited the migration ability and HIF-1α nuclear translocation of TNF-α induced FLS. Finally, suppressing SIRT1 levels in TNF-α induced FLS enhanced their migration ability, HIF-1α nuclear translocation, and the protein levels of HIF-1α, VEGF-A, and CD31, whereas the inhibitory effect of CSO on TNF-α induced FLS was severely constrained. CONCLUSIONS: This study indicates that CSO can alleviate synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in CIA rats. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13020-023-00833-6.
format Online
Article
Text
id pubmed-10504826
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-105048262023-09-17 Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats Xu, Qiangqiang Kong, Hongxi Ren, Shuang Meng, Fanyan Liu, Ruoshi Jin, Hongxin Zhang, Jie Chin Med Research BACKGROUND: Rheumatoid arthritis (RA) is a chronic autoimmune disorder characterized by symmetric arthritis. Coix Seed Oil (CSO) has been shown to reduce inflammation in collagen induced arthritis (CIA) rats. However, the effect of CSO on synovial angiogenesis in RA is unknown. In this study, we aimed to explore whether CSO could inhibit RA synovial angiogenesis and elucidate the underlying mechanisms. METHODS: CIA rat models were established and subjected to different doses of CSO treatments for four weeks in vivo. Arthritis index, paw swelling, and weight were recorded to assess clinical symptoms. Hematoxylin and Eosin staining, Safarnin O fast green staining, Micro-CT, Immunohistochemical, and Immunofluorescence (IF) staining were performed to examined changes in synovial and joint tissues. The serum HIF-1α and VEGF-A levels were evaluated through enzyme-linked immunosorbent assay. Fibroblast-like synoviocytes (FLS) of rats was stimulated with tumor necrosis factor-α (TNF-α) for developing inflammatory model in vitro. Optimal concentrations of CSO and TNF-α for stimulation were measured through Cell Counting Kit-8 test. Wound healing and Transwell migration experiments were employed to determine FLS migratory ability. IF staining was performed to assess HIF-1α nuclear translocation in FLS. Protein levels of SIRT1, HIF-1α, VEGF-A, and CD31 were assessed through Western blot. The isolated aortic rings were induced with recombinant rat VEGF-A 165 (VEGF-A(165)) to observe the CSO inhibitory impact on angiogenesis ex vivo. RESULTS: CSO attenuated the progression of arthritis in CIA rats, mitigated histopathological deterioration in synovial and joint tissues, significantly inhibited immature vessels labeled with CD31(+)/αSMA(−), and reduced the micro-vessels in VEGF-A(165) induced aortic rings. Moreover, it upregulated SIRT1 protein levels in CIA rats and TNF-α induced FLS, but decreased HIF-1α and VEGF-A protein levels. Furthermore, CSO inhibited the migration ability and HIF-1α nuclear translocation of TNF-α induced FLS. Finally, suppressing SIRT1 levels in TNF-α induced FLS enhanced their migration ability, HIF-1α nuclear translocation, and the protein levels of HIF-1α, VEGF-A, and CD31, whereas the inhibitory effect of CSO on TNF-α induced FLS was severely constrained. CONCLUSIONS: This study indicates that CSO can alleviate synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in CIA rats. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13020-023-00833-6. BioMed Central 2023-09-15 /pmc/articles/PMC10504826/ /pubmed/37715217 http://dx.doi.org/10.1186/s13020-023-00833-6 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/ Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Xu, Qiangqiang
Kong, Hongxi
Ren, Shuang
Meng, Fanyan
Liu, Ruoshi
Jin, Hongxin
Zhang, Jie
Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title_full Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title_fullStr Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title_full_unstemmed Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title_short Coix seed oil alleviates synovial angiogenesis through suppressing HIF-1α/VEGF-A signaling pathways via SIRT1 in collagen-induced arthritis rats
title_sort coix seed oil alleviates synovial angiogenesis through suppressing hif-1α/vegf-a signaling pathways via sirt1 in collagen-induced arthritis rats
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10504826/
https://www.ncbi.nlm.nih.gov/pubmed/37715217
http://dx.doi.org/10.1186/s13020-023-00833-6
work_keys_str_mv AT xuqiangqiang coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT konghongxi coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT renshuang coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT mengfanyan coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT liuruoshi coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT jinhongxin coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats
AT zhangjie coixseedoilalleviatessynovialangiogenesisthroughsuppressinghif1avegfasignalingpathwaysviasirt1incollageninducedarthritisrats