Cargando…

Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review

BACKGROUND: Lumbar spine injuries in fast bowlers account for the greatest missed playing time in cricket. A range of extrinsic and intrinsic variables are hypothesised to be associated with low back pain and lumbar spine injury in fast bowlers, and an improved understanding of intrinsic variables i...

Descripción completa

Detalles Bibliográficos
Autores principales: Farhart, Patrick, Beakley, David, Diwan, Ashish, Duffield, Rob, Rodriguez, Elizabeth Pickering, Chamoli, Uphar, Watsford, Mark
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10512628/
https://www.ncbi.nlm.nih.gov/pubmed/37730648
http://dx.doi.org/10.1186/s13102-023-00732-1
_version_ 1785108403538886656
author Farhart, Patrick
Beakley, David
Diwan, Ashish
Duffield, Rob
Rodriguez, Elizabeth Pickering
Chamoli, Uphar
Watsford, Mark
author_facet Farhart, Patrick
Beakley, David
Diwan, Ashish
Duffield, Rob
Rodriguez, Elizabeth Pickering
Chamoli, Uphar
Watsford, Mark
author_sort Farhart, Patrick
collection PubMed
description BACKGROUND: Lumbar spine injuries in fast bowlers account for the greatest missed playing time in cricket. A range of extrinsic and intrinsic variables are hypothesised to be associated with low back pain and lumbar spine injury in fast bowlers, and an improved understanding of intrinsic variables is necessary as these may alter load tolerance and injury risk associated with fast bowling. This review critically evaluated studies reporting intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers and identified areas for future investigation. METHODS: OVID Medline, EMBASE, SPORTDiscus, CINAHL, Web of Science and SCOPUS databases were last searched on 3 June 2022 to identify studies investigating intrinsic variables associated with low back pain and lumbar spine injury in cricket fast bowlers. Terms relevant to cricket fast bowling, and intrinsic variables associated with lumbar spine injury and low back pain in fast bowlers were searched. 1,503 abstracts were screened, and 118 full‐text articles were appraised to determine whether they met inclusion criteria. Two authors independently screened search results and assessed risk of bias using a modified version of the Quality in Prognostic Studies tool. RESULTS: Twenty-five studies met the inclusion criteria. Overall, no included studies demonstrated a low risk of bias, two studies were identified as moderate risk, and twenty-three studies were identified as high risk. Conflicting results were reported amongst studies investigating associations of fast bowling kinematics and kinetics, trunk and lumbar anatomical features, anthropometric traits, age, and neuromuscular characteristics with low back pain and lumbar spine injury. CONCLUSION: Inconsistencies in results may be related to differences in study design, injury definitions, participant characteristics, measurement parameters, and statistical analyses. Low back pain and lumbar spine injury occurrence in fast bowlers remain high, and this may be due to an absence of low bias studies that have informed recommendations for their prevention. Future research should employ clearly defined injury outcomes, analyse continuous datasets, utilise models that better represent lumbar kinematics and kinetics during fast bowling, and better quantify previous injury, lumbar anatomical features and lumbar maturation. TRIAL REGISTRATION: Open Science Framework 10.17605/OSF.IO/ERKZ2. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13102-023-00732-1.
format Online
Article
Text
id pubmed-10512628
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-105126282023-09-22 Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review Farhart, Patrick Beakley, David Diwan, Ashish Duffield, Rob Rodriguez, Elizabeth Pickering Chamoli, Uphar Watsford, Mark BMC Sports Sci Med Rehabil Research BACKGROUND: Lumbar spine injuries in fast bowlers account for the greatest missed playing time in cricket. A range of extrinsic and intrinsic variables are hypothesised to be associated with low back pain and lumbar spine injury in fast bowlers, and an improved understanding of intrinsic variables is necessary as these may alter load tolerance and injury risk associated with fast bowling. This review critically evaluated studies reporting intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers and identified areas for future investigation. METHODS: OVID Medline, EMBASE, SPORTDiscus, CINAHL, Web of Science and SCOPUS databases were last searched on 3 June 2022 to identify studies investigating intrinsic variables associated with low back pain and lumbar spine injury in cricket fast bowlers. Terms relevant to cricket fast bowling, and intrinsic variables associated with lumbar spine injury and low back pain in fast bowlers were searched. 1,503 abstracts were screened, and 118 full‐text articles were appraised to determine whether they met inclusion criteria. Two authors independently screened search results and assessed risk of bias using a modified version of the Quality in Prognostic Studies tool. RESULTS: Twenty-five studies met the inclusion criteria. Overall, no included studies demonstrated a low risk of bias, two studies were identified as moderate risk, and twenty-three studies were identified as high risk. Conflicting results were reported amongst studies investigating associations of fast bowling kinematics and kinetics, trunk and lumbar anatomical features, anthropometric traits, age, and neuromuscular characteristics with low back pain and lumbar spine injury. CONCLUSION: Inconsistencies in results may be related to differences in study design, injury definitions, participant characteristics, measurement parameters, and statistical analyses. Low back pain and lumbar spine injury occurrence in fast bowlers remain high, and this may be due to an absence of low bias studies that have informed recommendations for their prevention. Future research should employ clearly defined injury outcomes, analyse continuous datasets, utilise models that better represent lumbar kinematics and kinetics during fast bowling, and better quantify previous injury, lumbar anatomical features and lumbar maturation. TRIAL REGISTRATION: Open Science Framework 10.17605/OSF.IO/ERKZ2. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13102-023-00732-1. BioMed Central 2023-09-20 /pmc/articles/PMC10512628/ /pubmed/37730648 http://dx.doi.org/10.1186/s13102-023-00732-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Farhart, Patrick
Beakley, David
Diwan, Ashish
Duffield, Rob
Rodriguez, Elizabeth Pickering
Chamoli, Uphar
Watsford, Mark
Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title_full Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title_fullStr Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title_full_unstemmed Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title_short Intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
title_sort intrinsic variables associated with low back pain and lumbar spine injury in fast bowlers in cricket: a systematic review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10512628/
https://www.ncbi.nlm.nih.gov/pubmed/37730648
http://dx.doi.org/10.1186/s13102-023-00732-1
work_keys_str_mv AT farhartpatrick intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT beakleydavid intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT diwanashish intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT duffieldrob intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT rodriguezelizabethpickering intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT chamoliuphar intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview
AT watsfordmark intrinsicvariablesassociatedwithlowbackpainandlumbarspineinjuryinfastbowlersincricketasystematicreview