Cargando…
Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10518388/ https://www.ncbi.nlm.nih.gov/pubmed/37753078 http://dx.doi.org/10.3389/fimmu.2023.1242640 |
_version_ | 1785109502350065664 |
---|---|
author | Yang, Lin Zhou, Dan Cao, Jiaojiao Shi, Fangyuan Zeng, Jiaming Zhang, Siqi Yan, Guorui Chen, Zhihan Chen, Bo Guo, Yi Lin, Xiaowei |
author_facet | Yang, Lin Zhou, Dan Cao, Jiaojiao Shi, Fangyuan Zeng, Jiaming Zhang, Siqi Yan, Guorui Chen, Zhihan Chen, Bo Guo, Yi Lin, Xiaowei |
author_sort | Yang, Lin |
collection | PubMed |
description | Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its mechanism of action in recent years. In this review, we systematically discuss the current clinical applications of acupuncture in the treatment of sepsis and focus on the mechanisms of acupuncture in animal models of systemic inflammation. In clinical research, acupuncture can not only effectively inhibit excessive inflammatory reactions but also improve the immunosuppressive state of patients with sepsis, thus maintaining immune homeostasis. Mechanistically, a change in the acupoint microenvironment is the initial response link for acupuncture to take effect, whereas PROKR2 neurons, high-threshold thin nerve fibres, cannabinoid CB2 receptor (CB2R) activation, and Ca(2+) influx are the key material bases. The cholinergic anti-inflammatory pathway of the vagus nervous system, the adrenal dopamine anti-inflammatory pathway, and the sympathetic nervous system are key to the transmission of acupuncture information and the inhibition of systemic inflammation. In MODS, acupuncture protects against septic organ damage by inhibiting excessive inflammatory reactions, resisting oxidative stress, protecting mitochondrial function, and reducing apoptosis and tissue or organ damage. |
format | Online Article Text |
id | pubmed-10518388 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-105183882023-09-26 Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review Yang, Lin Zhou, Dan Cao, Jiaojiao Shi, Fangyuan Zeng, Jiaming Zhang, Siqi Yan, Guorui Chen, Zhihan Chen, Bo Guo, Yi Lin, Xiaowei Front Immunol Immunology Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its mechanism of action in recent years. In this review, we systematically discuss the current clinical applications of acupuncture in the treatment of sepsis and focus on the mechanisms of acupuncture in animal models of systemic inflammation. In clinical research, acupuncture can not only effectively inhibit excessive inflammatory reactions but also improve the immunosuppressive state of patients with sepsis, thus maintaining immune homeostasis. Mechanistically, a change in the acupoint microenvironment is the initial response link for acupuncture to take effect, whereas PROKR2 neurons, high-threshold thin nerve fibres, cannabinoid CB2 receptor (CB2R) activation, and Ca(2+) influx are the key material bases. The cholinergic anti-inflammatory pathway of the vagus nervous system, the adrenal dopamine anti-inflammatory pathway, and the sympathetic nervous system are key to the transmission of acupuncture information and the inhibition of systemic inflammation. In MODS, acupuncture protects against septic organ damage by inhibiting excessive inflammatory reactions, resisting oxidative stress, protecting mitochondrial function, and reducing apoptosis and tissue or organ damage. Frontiers Media S.A. 2023-09-11 /pmc/articles/PMC10518388/ /pubmed/37753078 http://dx.doi.org/10.3389/fimmu.2023.1242640 Text en Copyright © 2023 Yang, Zhou, Cao, Shi, Zeng, Zhang, Yan, Chen, Chen, Guo and Lin https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Yang, Lin Zhou, Dan Cao, Jiaojiao Shi, Fangyuan Zeng, Jiaming Zhang, Siqi Yan, Guorui Chen, Zhihan Chen, Bo Guo, Yi Lin, Xiaowei Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title | Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title_full | Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title_fullStr | Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title_full_unstemmed | Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title_short | Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
title_sort | revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10518388/ https://www.ncbi.nlm.nih.gov/pubmed/37753078 http://dx.doi.org/10.3389/fimmu.2023.1242640 |
work_keys_str_mv | AT yanglin revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT zhoudan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT caojiaojiao revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT shifangyuan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT zengjiaming revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT zhangsiqi revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT yanguorui revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT chenzhihan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT chenbo revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT guoyi revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview AT linxiaowei revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview |