Cargando…

Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review

Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Lin, Zhou, Dan, Cao, Jiaojiao, Shi, Fangyuan, Zeng, Jiaming, Zhang, Siqi, Yan, Guorui, Chen, Zhihan, Chen, Bo, Guo, Yi, Lin, Xiaowei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10518388/
https://www.ncbi.nlm.nih.gov/pubmed/37753078
http://dx.doi.org/10.3389/fimmu.2023.1242640
_version_ 1785109502350065664
author Yang, Lin
Zhou, Dan
Cao, Jiaojiao
Shi, Fangyuan
Zeng, Jiaming
Zhang, Siqi
Yan, Guorui
Chen, Zhihan
Chen, Bo
Guo, Yi
Lin, Xiaowei
author_facet Yang, Lin
Zhou, Dan
Cao, Jiaojiao
Shi, Fangyuan
Zeng, Jiaming
Zhang, Siqi
Yan, Guorui
Chen, Zhihan
Chen, Bo
Guo, Yi
Lin, Xiaowei
author_sort Yang, Lin
collection PubMed
description Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its mechanism of action in recent years. In this review, we systematically discuss the current clinical applications of acupuncture in the treatment of sepsis and focus on the mechanisms of acupuncture in animal models of systemic inflammation. In clinical research, acupuncture can not only effectively inhibit excessive inflammatory reactions but also improve the immunosuppressive state of patients with sepsis, thus maintaining immune homeostasis. Mechanistically, a change in the acupoint microenvironment is the initial response link for acupuncture to take effect, whereas PROKR2 neurons, high-threshold thin nerve fibres, cannabinoid CB2 receptor (CB2R) activation, and Ca(2+) influx are the key material bases. The cholinergic anti-inflammatory pathway of the vagus nervous system, the adrenal dopamine anti-inflammatory pathway, and the sympathetic nervous system are key to the transmission of acupuncture information and the inhibition of systemic inflammation. In MODS, acupuncture protects against septic organ damage by inhibiting excessive inflammatory reactions, resisting oxidative stress, protecting mitochondrial function, and reducing apoptosis and tissue or organ damage.
format Online
Article
Text
id pubmed-10518388
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-105183882023-09-26 Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review Yang, Lin Zhou, Dan Cao, Jiaojiao Shi, Fangyuan Zeng, Jiaming Zhang, Siqi Yan, Guorui Chen, Zhihan Chen, Bo Guo, Yi Lin, Xiaowei Front Immunol Immunology Sepsis is a systemic inflammation caused by a maladjusted host response to infection. In severe cases, it can cause multiple organ dysfunction syndrome (MODS) and even endanger life. Acupuncture is widely accepted and applied in the treatment of sepsis, and breakthroughs have been made regarding its mechanism of action in recent years. In this review, we systematically discuss the current clinical applications of acupuncture in the treatment of sepsis and focus on the mechanisms of acupuncture in animal models of systemic inflammation. In clinical research, acupuncture can not only effectively inhibit excessive inflammatory reactions but also improve the immunosuppressive state of patients with sepsis, thus maintaining immune homeostasis. Mechanistically, a change in the acupoint microenvironment is the initial response link for acupuncture to take effect, whereas PROKR2 neurons, high-threshold thin nerve fibres, cannabinoid CB2 receptor (CB2R) activation, and Ca(2+) influx are the key material bases. The cholinergic anti-inflammatory pathway of the vagus nervous system, the adrenal dopamine anti-inflammatory pathway, and the sympathetic nervous system are key to the transmission of acupuncture information and the inhibition of systemic inflammation. In MODS, acupuncture protects against septic organ damage by inhibiting excessive inflammatory reactions, resisting oxidative stress, protecting mitochondrial function, and reducing apoptosis and tissue or organ damage. Frontiers Media S.A. 2023-09-11 /pmc/articles/PMC10518388/ /pubmed/37753078 http://dx.doi.org/10.3389/fimmu.2023.1242640 Text en Copyright © 2023 Yang, Zhou, Cao, Shi, Zeng, Zhang, Yan, Chen, Chen, Guo and Lin https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Immunology
Yang, Lin
Zhou, Dan
Cao, Jiaojiao
Shi, Fangyuan
Zeng, Jiaming
Zhang, Siqi
Yan, Guorui
Chen, Zhihan
Chen, Bo
Guo, Yi
Lin, Xiaowei
Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title_full Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title_fullStr Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title_full_unstemmed Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title_short Revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
title_sort revealing the biological mechanism of acupuncture in alleviating excessive inflammatory responses and organ damage in sepsis: a systematic review
topic Immunology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10518388/
https://www.ncbi.nlm.nih.gov/pubmed/37753078
http://dx.doi.org/10.3389/fimmu.2023.1242640
work_keys_str_mv AT yanglin revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT zhoudan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT caojiaojiao revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT shifangyuan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT zengjiaming revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT zhangsiqi revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT yanguorui revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT chenzhihan revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT chenbo revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT guoyi revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview
AT linxiaowei revealingthebiologicalmechanismofacupunctureinalleviatingexcessiveinflammatoryresponsesandorgandamageinsepsisasystematicreview