Cargando…

A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring

This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction bet...

Descripción completa

Detalles Bibliográficos
Autores principales: Alhazzani, Khalid, Alanazi, Ahmed Z., Mostafa, Aya M., Barker, James, El-Wekil, Mohamed M., Bellah H. Ali, Al-Montaser
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Royal Society of Chemistry 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10545982/
https://www.ncbi.nlm.nih.gov/pubmed/37795051
http://dx.doi.org/10.1039/d3ra04894b
_version_ 1785114781437394944
author Alhazzani, Khalid
Alanazi, Ahmed Z.
Mostafa, Aya M.
Barker, James
El-Wekil, Mohamed M.
Bellah H. Ali, Al-Montaser
author_facet Alhazzani, Khalid
Alanazi, Ahmed Z.
Mostafa, Aya M.
Barker, James
El-Wekil, Mohamed M.
Bellah H. Ali, Al-Montaser
author_sort Alhazzani, Khalid
collection PubMed
description This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction between the studied drugs and EY/BG@CDs sensor components allows for their simultaneous detection where GNT quenches the fluorescence of EY at 535 nm without affecting the fluorescence of CDs, while KET quenches the fluorescence of BG@CDs at 385 nm without impacting EY fluorescence. The BG@CDs probe was successfully characterized using various techniques such as absorption spectrophotometry, spectrofluorimetry, TEM imaging, infrared spectroscopic analysis, and XRD analysis. The suggested methodology was observed to be highly sensitive for the simultaneous determination of GNT and KET in their spiked rabbit plasma samples, with wide linear ranges and low limit of detection (LOD) values. The studied drugs were extracted using a highly selective extraction method involving protein precipitation followed by mixed mode solid phase extraction using an Oasis WCX cartridge. The simultaneous determination of GNT and KET is essential due to the potential interactions between the studied drugs. Therefore, this analysis can be used to evaluate the necessity of dose monitoring and the potential adverse effects of co-administration of these drugs.
format Online
Article
Text
id pubmed-10545982
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher The Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-105459822023-10-04 A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring Alhazzani, Khalid Alanazi, Ahmed Z. Mostafa, Aya M. Barker, James El-Wekil, Mohamed M. Bellah H. Ali, Al-Montaser RSC Adv Chemistry This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction between the studied drugs and EY/BG@CDs sensor components allows for their simultaneous detection where GNT quenches the fluorescence of EY at 535 nm without affecting the fluorescence of CDs, while KET quenches the fluorescence of BG@CDs at 385 nm without impacting EY fluorescence. The BG@CDs probe was successfully characterized using various techniques such as absorption spectrophotometry, spectrofluorimetry, TEM imaging, infrared spectroscopic analysis, and XRD analysis. The suggested methodology was observed to be highly sensitive for the simultaneous determination of GNT and KET in their spiked rabbit plasma samples, with wide linear ranges and low limit of detection (LOD) values. The studied drugs were extracted using a highly selective extraction method involving protein precipitation followed by mixed mode solid phase extraction using an Oasis WCX cartridge. The simultaneous determination of GNT and KET is essential due to the potential interactions between the studied drugs. Therefore, this analysis can be used to evaluate the necessity of dose monitoring and the potential adverse effects of co-administration of these drugs. The Royal Society of Chemistry 2023-10-03 /pmc/articles/PMC10545982/ /pubmed/37795051 http://dx.doi.org/10.1039/d3ra04894b Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by/3.0/
spellingShingle Chemistry
Alhazzani, Khalid
Alanazi, Ahmed Z.
Mostafa, Aya M.
Barker, James
El-Wekil, Mohamed M.
Bellah H. Ali, Al-Montaser
A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title_full A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title_fullStr A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title_full_unstemmed A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title_short A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
title_sort selective dual quenching sensor (ey/bg@cds) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10545982/
https://www.ncbi.nlm.nih.gov/pubmed/37795051
http://dx.doi.org/10.1039/d3ra04894b
work_keys_str_mv AT alhazzanikhalid aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT alanaziahmedz aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT mostafaayam aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT barkerjames aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT elwekilmohamedm aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT bellahhalialmontaser aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT alhazzanikhalid selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT alanaziahmedz selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT mostafaayam selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT barkerjames selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT elwekilmohamedm selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring
AT bellahhalialmontaser selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring