Cargando…
A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring
This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction bet...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Royal Society of Chemistry
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10545982/ https://www.ncbi.nlm.nih.gov/pubmed/37795051 http://dx.doi.org/10.1039/d3ra04894b |
_version_ | 1785114781437394944 |
---|---|
author | Alhazzani, Khalid Alanazi, Ahmed Z. Mostafa, Aya M. Barker, James El-Wekil, Mohamed M. Bellah H. Ali, Al-Montaser |
author_facet | Alhazzani, Khalid Alanazi, Ahmed Z. Mostafa, Aya M. Barker, James El-Wekil, Mohamed M. Bellah H. Ali, Al-Montaser |
author_sort | Alhazzani, Khalid |
collection | PubMed |
description | This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction between the studied drugs and EY/BG@CDs sensor components allows for their simultaneous detection where GNT quenches the fluorescence of EY at 535 nm without affecting the fluorescence of CDs, while KET quenches the fluorescence of BG@CDs at 385 nm without impacting EY fluorescence. The BG@CDs probe was successfully characterized using various techniques such as absorption spectrophotometry, spectrofluorimetry, TEM imaging, infrared spectroscopic analysis, and XRD analysis. The suggested methodology was observed to be highly sensitive for the simultaneous determination of GNT and KET in their spiked rabbit plasma samples, with wide linear ranges and low limit of detection (LOD) values. The studied drugs were extracted using a highly selective extraction method involving protein precipitation followed by mixed mode solid phase extraction using an Oasis WCX cartridge. The simultaneous determination of GNT and KET is essential due to the potential interactions between the studied drugs. Therefore, this analysis can be used to evaluate the necessity of dose monitoring and the potential adverse effects of co-administration of these drugs. |
format | Online Article Text |
id | pubmed-10545982 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | The Royal Society of Chemistry |
record_format | MEDLINE/PubMed |
spelling | pubmed-105459822023-10-04 A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring Alhazzani, Khalid Alanazi, Ahmed Z. Mostafa, Aya M. Barker, James El-Wekil, Mohamed M. Bellah H. Ali, Al-Montaser RSC Adv Chemistry This research work introduces a novel sensor that utilizes two fluorophores to enable simultaneous monitoring of gentamicin sulphate (GNT) and ketorolac tromethamine (KET). The innovative sensor is composed of carbon dots (CDs) derived from black grapes (BG) and eosin Y (EY) dye. The interaction between the studied drugs and EY/BG@CDs sensor components allows for their simultaneous detection where GNT quenches the fluorescence of EY at 535 nm without affecting the fluorescence of CDs, while KET quenches the fluorescence of BG@CDs at 385 nm without impacting EY fluorescence. The BG@CDs probe was successfully characterized using various techniques such as absorption spectrophotometry, spectrofluorimetry, TEM imaging, infrared spectroscopic analysis, and XRD analysis. The suggested methodology was observed to be highly sensitive for the simultaneous determination of GNT and KET in their spiked rabbit plasma samples, with wide linear ranges and low limit of detection (LOD) values. The studied drugs were extracted using a highly selective extraction method involving protein precipitation followed by mixed mode solid phase extraction using an Oasis WCX cartridge. The simultaneous determination of GNT and KET is essential due to the potential interactions between the studied drugs. Therefore, this analysis can be used to evaluate the necessity of dose monitoring and the potential adverse effects of co-administration of these drugs. The Royal Society of Chemistry 2023-10-03 /pmc/articles/PMC10545982/ /pubmed/37795051 http://dx.doi.org/10.1039/d3ra04894b Text en This journal is © The Royal Society of Chemistry https://creativecommons.org/licenses/by/3.0/ |
spellingShingle | Chemistry Alhazzani, Khalid Alanazi, Ahmed Z. Mostafa, Aya M. Barker, James El-Wekil, Mohamed M. Bellah H. Ali, Al-Montaser A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title | A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title_full | A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title_fullStr | A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title_full_unstemmed | A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title_short | A selective dual quenching sensor (EY/BG@CDs) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
title_sort | selective dual quenching sensor (ey/bg@cds) for simultaneous monitoring of gentamicin and ketorolac levels in plasma: a highly efficient platform that caters to the needs of therapeutic drug monitoring |
topic | Chemistry |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10545982/ https://www.ncbi.nlm.nih.gov/pubmed/37795051 http://dx.doi.org/10.1039/d3ra04894b |
work_keys_str_mv | AT alhazzanikhalid aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT alanaziahmedz aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT mostafaayam aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT barkerjames aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT elwekilmohamedm aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT bellahhalialmontaser aselectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT alhazzanikhalid selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT alanaziahmedz selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT mostafaayam selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT barkerjames selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT elwekilmohamedm selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring AT bellahhalialmontaser selectivedualquenchingsensoreybgcdsforsimultaneousmonitoringofgentamicinandketorolaclevelsinplasmaahighlyefficientplatformthatcaterstotheneedsoftherapeuticdrugmonitoring |