Cargando…
Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance
INTRODUCTION: Research findings of the past decade have highlighted the gut as the main site of action of the oral antihyperglycemic agent metformin despite its pharmacological role in the liver. Extensive evidence supports metformin’s modulatory effect on the composition and function of gut microbi...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10546317/ https://www.ncbi.nlm.nih.gov/pubmed/37795356 http://dx.doi.org/10.3389/fendo.2023.1232143 |
_version_ | 1785114847227150336 |
---|---|
author | Brīvība, Monta Silamiķele, Laila Kalniņa, Ineta Silamiķelis, Ivars Birzniece, Līga Ansone, Laura Jagare, Lauma Elbere, Ilze Kloviņš, Jānis |
author_facet | Brīvība, Monta Silamiķele, Laila Kalniņa, Ineta Silamiķelis, Ivars Birzniece, Līga Ansone, Laura Jagare, Lauma Elbere, Ilze Kloviņš, Jānis |
author_sort | Brīvība, Monta |
collection | PubMed |
description | INTRODUCTION: Research findings of the past decade have highlighted the gut as the main site of action of the oral antihyperglycemic agent metformin despite its pharmacological role in the liver. Extensive evidence supports metformin’s modulatory effect on the composition and function of gut microbiota, nevertheless, the underlying mechanisms of the host responses remain elusive. Our study aimed to evaluate metformin-induced alterations in the intestinal transcriptome profiles at different metabolic states. METHODS: The high-fat diet-induced mouse model of obesity and insulin resistance of both sexes was developed in a randomized block experiment and bulk RNA-Seq of the ileum tissue was the method of choice for comparative transcriptional profiling after metformin intervention for ten weeks. RESULTS: We found a prominent transcriptional effect of the diet itself with comparatively fewer genes responding to metformin intervention. The overrepresentation of immune-related genes was observed, including pronounced metformin-induced upregulation of immunoglobulin heavy-chain variable region coding Ighv1-7 gene in both high-fat diet and control diet-fed animals. Moreover, we provide evidence of the downregulation NF-kappa B signaling pathway in the small intestine of both obese and insulin-resistant animals as well as control animals after metformin treatment. Finally, our data pinpoint the gut microbiota as a crucial component in the metformin-mediated downregulation of NF-kappa B signaling evidenced by a positive correlation between the Rel and Rela gene expression levels and abundances of Parabacteroides distasonis, Bacteroides spp., and Lactobacillus spp. in the gut microbiota of the same animals. DISCUSSION: Our study supports the immunomodulatory effect of metformin in the ileum of obese and insulin-resistant C57BL/6N mice contributed by intestinal immunoglobulin responses, with a prominent emphasis on the downregulation of NF-kappa B signaling pathway, associated with alterations in the composition of the gut microbiome. |
format | Online Article Text |
id | pubmed-10546317 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-105463172023-10-04 Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance Brīvība, Monta Silamiķele, Laila Kalniņa, Ineta Silamiķelis, Ivars Birzniece, Līga Ansone, Laura Jagare, Lauma Elbere, Ilze Kloviņš, Jānis Front Endocrinol (Lausanne) Endocrinology INTRODUCTION: Research findings of the past decade have highlighted the gut as the main site of action of the oral antihyperglycemic agent metformin despite its pharmacological role in the liver. Extensive evidence supports metformin’s modulatory effect on the composition and function of gut microbiota, nevertheless, the underlying mechanisms of the host responses remain elusive. Our study aimed to evaluate metformin-induced alterations in the intestinal transcriptome profiles at different metabolic states. METHODS: The high-fat diet-induced mouse model of obesity and insulin resistance of both sexes was developed in a randomized block experiment and bulk RNA-Seq of the ileum tissue was the method of choice for comparative transcriptional profiling after metformin intervention for ten weeks. RESULTS: We found a prominent transcriptional effect of the diet itself with comparatively fewer genes responding to metformin intervention. The overrepresentation of immune-related genes was observed, including pronounced metformin-induced upregulation of immunoglobulin heavy-chain variable region coding Ighv1-7 gene in both high-fat diet and control diet-fed animals. Moreover, we provide evidence of the downregulation NF-kappa B signaling pathway in the small intestine of both obese and insulin-resistant animals as well as control animals after metformin treatment. Finally, our data pinpoint the gut microbiota as a crucial component in the metformin-mediated downregulation of NF-kappa B signaling evidenced by a positive correlation between the Rel and Rela gene expression levels and abundances of Parabacteroides distasonis, Bacteroides spp., and Lactobacillus spp. in the gut microbiota of the same animals. DISCUSSION: Our study supports the immunomodulatory effect of metformin in the ileum of obese and insulin-resistant C57BL/6N mice contributed by intestinal immunoglobulin responses, with a prominent emphasis on the downregulation of NF-kappa B signaling pathway, associated with alterations in the composition of the gut microbiome. Frontiers Media S.A. 2023-09-19 /pmc/articles/PMC10546317/ /pubmed/37795356 http://dx.doi.org/10.3389/fendo.2023.1232143 Text en Copyright © 2023 Brīvība, Silamiķele, Kalniņa, Silamiķelis, Birzniece, Ansone, Jagare, Elbere and Kloviņš https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Endocrinology Brīvība, Monta Silamiķele, Laila Kalniņa, Ineta Silamiķelis, Ivars Birzniece, Līga Ansone, Laura Jagare, Lauma Elbere, Ilze Kloviņš, Jānis Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title | Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title_full | Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title_fullStr | Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title_full_unstemmed | Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title_short | Metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
title_sort | metformin targets intestinal immune system signaling pathways in a high-fat diet-induced mouse model of obesity and insulin resistance |
topic | Endocrinology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10546317/ https://www.ncbi.nlm.nih.gov/pubmed/37795356 http://dx.doi.org/10.3389/fendo.2023.1232143 |
work_keys_str_mv | AT brivibamonta metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT silamikelelaila metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT kalninaineta metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT silamikelisivars metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT birznieceliga metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT ansonelaura metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT jagarelauma metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT elbereilze metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance AT klovinsjanis metformintargetsintestinalimmunesystemsignalingpathwaysinahighfatdietinducedmousemodelofobesityandinsulinresistance |