Cargando…

Job adjustment predictive factors of healthcare midwives in health system reform in Iran

BACKGROUND: Possessing sensitive and multiple responsibilities in the country's health system, particularly after the implementation of the health reform in Iran, midwives must be able to optimally perform their duties in their new job as healthcare providers. This study aimed to identify the f...

Descripción completa

Detalles Bibliográficos
Autores principales: Moradali, Monireh Rezaee, Hajian, Sepideh, Majd, Hamid Alavi, Rahbar, Mohammadreza, Entezarmahdi, Rasool
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10563211/
https://www.ncbi.nlm.nih.gov/pubmed/37817271
http://dx.doi.org/10.1186/s13690-023-01193-1
_version_ 1785118289011146752
author Moradali, Monireh Rezaee
Hajian, Sepideh
Majd, Hamid Alavi
Rahbar, Mohammadreza
Entezarmahdi, Rasool
author_facet Moradali, Monireh Rezaee
Hajian, Sepideh
Majd, Hamid Alavi
Rahbar, Mohammadreza
Entezarmahdi, Rasool
author_sort Moradali, Monireh Rezaee
collection PubMed
description BACKGROUND: Possessing sensitive and multiple responsibilities in the country's health system, particularly after the implementation of the health reform in Iran, midwives must be able to optimally perform their duties in their new job as healthcare providers. This study aimed to identify the factors that predict job adjustment for Iranian midwives working in healthcare. METHODS: In this cross-sectional study, 310 midwives were recruited from 209 health centers in the Iranian province of West Azerbaijan using the census method and asked to complete research questionnaires. Data were collected using job adjustment, job satisfaction, and organizational commitment scales. SPSS version 25 was used to perform ANOVA and calculate multiple linear regression coefficients for data analysis. In addition, the AMOS software was employed for path analysis and the identification of predictive variables. RESULTS: The mean age of the participants was 37.67 ± 7.1 years. Most participants (35.5%) were interested in their occupation as a midwife, and 27.1% were very interest. They had a moderate to strong tendency (76.1%) to remain in their new profession. In addition, 58.1% of participants experienced moderate job adjustment. For healthcare midwives, "desire to remain in the midwifery profession" and "organizational commitment" were significant predictors of job adjustment. "Desire to remain in the midwifery profession" directly affected midwives' job adjustment, while "interest in the new profession" had an indirect effect. Furthermore, "adequacy of income to expenses," "job satisfaction," and "organizational commitment" through the mediating role of "desire to remain in the profession" can, directly and indirectly, influence their job adjustment. CONCLUSION: To better prepare midwives for their role as healthcare providers, organizational managers should focus their efforts and plan primarily on providing incentives to increase the longevity of staying in the profession of midwifery increase job adjustment, job satisfaction, and organizational commitment, thereby improving the quality-of-service delivery.
format Online
Article
Text
id pubmed-10563211
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-105632112023-10-11 Job adjustment predictive factors of healthcare midwives in health system reform in Iran Moradali, Monireh Rezaee Hajian, Sepideh Majd, Hamid Alavi Rahbar, Mohammadreza Entezarmahdi, Rasool Arch Public Health Research BACKGROUND: Possessing sensitive and multiple responsibilities in the country's health system, particularly after the implementation of the health reform in Iran, midwives must be able to optimally perform their duties in their new job as healthcare providers. This study aimed to identify the factors that predict job adjustment for Iranian midwives working in healthcare. METHODS: In this cross-sectional study, 310 midwives were recruited from 209 health centers in the Iranian province of West Azerbaijan using the census method and asked to complete research questionnaires. Data were collected using job adjustment, job satisfaction, and organizational commitment scales. SPSS version 25 was used to perform ANOVA and calculate multiple linear regression coefficients for data analysis. In addition, the AMOS software was employed for path analysis and the identification of predictive variables. RESULTS: The mean age of the participants was 37.67 ± 7.1 years. Most participants (35.5%) were interested in their occupation as a midwife, and 27.1% were very interest. They had a moderate to strong tendency (76.1%) to remain in their new profession. In addition, 58.1% of participants experienced moderate job adjustment. For healthcare midwives, "desire to remain in the midwifery profession" and "organizational commitment" were significant predictors of job adjustment. "Desire to remain in the midwifery profession" directly affected midwives' job adjustment, while "interest in the new profession" had an indirect effect. Furthermore, "adequacy of income to expenses," "job satisfaction," and "organizational commitment" through the mediating role of "desire to remain in the profession" can, directly and indirectly, influence their job adjustment. CONCLUSION: To better prepare midwives for their role as healthcare providers, organizational managers should focus their efforts and plan primarily on providing incentives to increase the longevity of staying in the profession of midwifery increase job adjustment, job satisfaction, and organizational commitment, thereby improving the quality-of-service delivery. BioMed Central 2023-10-10 /pmc/articles/PMC10563211/ /pubmed/37817271 http://dx.doi.org/10.1186/s13690-023-01193-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Moradali, Monireh Rezaee
Hajian, Sepideh
Majd, Hamid Alavi
Rahbar, Mohammadreza
Entezarmahdi, Rasool
Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title_full Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title_fullStr Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title_full_unstemmed Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title_short Job adjustment predictive factors of healthcare midwives in health system reform in Iran
title_sort job adjustment predictive factors of healthcare midwives in health system reform in iran
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10563211/
https://www.ncbi.nlm.nih.gov/pubmed/37817271
http://dx.doi.org/10.1186/s13690-023-01193-1
work_keys_str_mv AT moradalimonirehrezaee jobadjustmentpredictivefactorsofhealthcaremidwivesinhealthsystemreforminiran
AT hajiansepideh jobadjustmentpredictivefactorsofhealthcaremidwivesinhealthsystemreforminiran
AT majdhamidalavi jobadjustmentpredictivefactorsofhealthcaremidwivesinhealthsystemreforminiran
AT rahbarmohammadreza jobadjustmentpredictivefactorsofhealthcaremidwivesinhealthsystemreforminiran
AT entezarmahdirasool jobadjustmentpredictivefactorsofhealthcaremidwivesinhealthsystemreforminiran