Cargando…
Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms
VQ motif-containing (VQ) proteins are a class of transcription regulatory cofactors widely present in plants, playing crucial roles in growth and development, stress response, and defense. Although there have been some reports on the member identification and functional research of VQ genes in some...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573558/ https://www.ncbi.nlm.nih.gov/pubmed/37834416 http://dx.doi.org/10.3390/ijms241914968 |
_version_ | 1785120492197249024 |
---|---|
author | Tian, Jinfu Zhang, Jiahui Francis, Frédéric |
author_facet | Tian, Jinfu Zhang, Jiahui Francis, Frédéric |
author_sort | Tian, Jinfu |
collection | PubMed |
description | VQ motif-containing (VQ) proteins are a class of transcription regulatory cofactors widely present in plants, playing crucial roles in growth and development, stress response, and defense. Although there have been some reports on the member identification and functional research of VQ genes in some plants, there is still a lack of large-scale identification and clear graphical presentation of their basic characterization information to help us to better understand this family. Especially in gymnosperms, the VQ family genes and their evolutionary relationships have not yet been reported. In this study, we systematically identified 2469 VQ genes from 56 plant species, including bryophytes, gymnosperms, and angiosperms, and analyzed their molecular and evolutionary features. We found that amino acids are only highly conserved in the VQ domain, while other positions are relatively variable; most VQ genes encode relatively small proteins and do not have introns. The GC content in Poaceae plants is the highest (up to 70%); these VQ proteins can be divided into nine subgroups. In particular, we analyzed the molecular characteristics, chromosome distribution, duplication events, and expression levels of VQ genes in three gymnosperms: Ginkgo biloba, Taxus chinensis, and Pinus tabuliformis. In gymnosperms, VQ genes are classified into 11 groups, with highly similar motifs in each group; most VQ proteins have less than 300 amino acids and are predicted to be located in nucleus. Tandem duplication is an important driving force for the expansion of the VQ gene family, and the evolutionary processes of most VQ genes and duplication events are relatively independent; some candidate VQ genes are preliminarily screened, and they are likely to be involved in plant growth and stress and defense responses. These results provide detailed information and powerful references for further understanding and utilizing the VQ family genes in various plants. |
format | Online Article Text |
id | pubmed-10573558 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-105735582023-10-14 Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms Tian, Jinfu Zhang, Jiahui Francis, Frédéric Int J Mol Sci Article VQ motif-containing (VQ) proteins are a class of transcription regulatory cofactors widely present in plants, playing crucial roles in growth and development, stress response, and defense. Although there have been some reports on the member identification and functional research of VQ genes in some plants, there is still a lack of large-scale identification and clear graphical presentation of their basic characterization information to help us to better understand this family. Especially in gymnosperms, the VQ family genes and their evolutionary relationships have not yet been reported. In this study, we systematically identified 2469 VQ genes from 56 plant species, including bryophytes, gymnosperms, and angiosperms, and analyzed their molecular and evolutionary features. We found that amino acids are only highly conserved in the VQ domain, while other positions are relatively variable; most VQ genes encode relatively small proteins and do not have introns. The GC content in Poaceae plants is the highest (up to 70%); these VQ proteins can be divided into nine subgroups. In particular, we analyzed the molecular characteristics, chromosome distribution, duplication events, and expression levels of VQ genes in three gymnosperms: Ginkgo biloba, Taxus chinensis, and Pinus tabuliformis. In gymnosperms, VQ genes are classified into 11 groups, with highly similar motifs in each group; most VQ proteins have less than 300 amino acids and are predicted to be located in nucleus. Tandem duplication is an important driving force for the expansion of the VQ gene family, and the evolutionary processes of most VQ genes and duplication events are relatively independent; some candidate VQ genes are preliminarily screened, and they are likely to be involved in plant growth and stress and defense responses. These results provide detailed information and powerful references for further understanding and utilizing the VQ family genes in various plants. MDPI 2023-10-06 /pmc/articles/PMC10573558/ /pubmed/37834416 http://dx.doi.org/10.3390/ijms241914968 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Tian, Jinfu Zhang, Jiahui Francis, Frédéric Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title | Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title_full | Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title_fullStr | Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title_full_unstemmed | Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title_short | Large-Scale Identification and Characterization Analysis of VQ Family Genes in Plants, Especially Gymnosperms |
title_sort | large-scale identification and characterization analysis of vq family genes in plants, especially gymnosperms |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573558/ https://www.ncbi.nlm.nih.gov/pubmed/37834416 http://dx.doi.org/10.3390/ijms241914968 |
work_keys_str_mv | AT tianjinfu largescaleidentificationandcharacterizationanalysisofvqfamilygenesinplantsespeciallygymnosperms AT zhangjiahui largescaleidentificationandcharacterizationanalysisofvqfamilygenesinplantsespeciallygymnosperms AT francisfrederic largescaleidentificationandcharacterizationanalysisofvqfamilygenesinplantsespeciallygymnosperms |