Cargando…

Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study

Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/...

Descripción completa

Detalles Bibliográficos
Autores principales: Pérez-Jeldres, Tamara, Bustamante, M. Leonor, Segovia-Melero, Roberto, Aguilar, Nataly, Magne, Fabien, Ascui, Gabriel, Uribe, Denisse, Azócar, Lorena, Hernández-Rocha, Cristián, Estela, Ricardo, Silva, Verónica, De La Vega, Andrés, Arriagada, Elizabeth, Gonzalez, Mauricio, Onetto, Gian-Franco, Escobar, Sergio, Baez, Pablo, Zazueta, Alejandra, Pavez-Ovalle, Carolina, Miquel, Juan Francisco, Álvarez-Lobos, Manuel
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573577/
https://www.ncbi.nlm.nih.gov/pubmed/37834314
http://dx.doi.org/10.3390/ijms241914866
_version_ 1785120496633774080
author Pérez-Jeldres, Tamara
Bustamante, M. Leonor
Segovia-Melero, Roberto
Aguilar, Nataly
Magne, Fabien
Ascui, Gabriel
Uribe, Denisse
Azócar, Lorena
Hernández-Rocha, Cristián
Estela, Ricardo
Silva, Verónica
De La Vega, Andrés
Arriagada, Elizabeth
Gonzalez, Mauricio
Onetto, Gian-Franco
Escobar, Sergio
Baez, Pablo
Zazueta, Alejandra
Pavez-Ovalle, Carolina
Miquel, Juan Francisco
Álvarez-Lobos, Manuel
author_facet Pérez-Jeldres, Tamara
Bustamante, M. Leonor
Segovia-Melero, Roberto
Aguilar, Nataly
Magne, Fabien
Ascui, Gabriel
Uribe, Denisse
Azócar, Lorena
Hernández-Rocha, Cristián
Estela, Ricardo
Silva, Verónica
De La Vega, Andrés
Arriagada, Elizabeth
Gonzalez, Mauricio
Onetto, Gian-Franco
Escobar, Sergio
Baez, Pablo
Zazueta, Alejandra
Pavez-Ovalle, Carolina
Miquel, Juan Francisco
Álvarez-Lobos, Manuel
author_sort Pérez-Jeldres, Tamara
collection PubMed
description Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/Vitamin D Receptor (VDR) gene variants. Blood samples were analyzed using Illumina’s Infinium Global Screening Array. The LCT-13910 CC genotype was found in 61% of IBD patients, similar to Chilean Hispanic controls and lower than Chilean Amerindian controls. The frequency of the LCT-13910-C allele in Chilean IBD patients (0.79) was comparable to the general population and higher than Europeans (0.49). Regarding VDR and VDD variants, in our study, the rs12785878-GG variant was associated with an increased risk of IBD (OR = 2.64, CI = 1.61–4.32; p-value = 0.001). Sixty-one percent of the Chilean IBD cohort have a genetic predisposition to lactose malabsorption, and a significant proportion exhibit genetic variants associated with VDD/VDR. Screening for LI and VDD is crucial in this Latin American IBD population.
format Online
Article
Text
id pubmed-10573577
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-105735772023-10-14 Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study Pérez-Jeldres, Tamara Bustamante, M. Leonor Segovia-Melero, Roberto Aguilar, Nataly Magne, Fabien Ascui, Gabriel Uribe, Denisse Azócar, Lorena Hernández-Rocha, Cristián Estela, Ricardo Silva, Verónica De La Vega, Andrés Arriagada, Elizabeth Gonzalez, Mauricio Onetto, Gian-Franco Escobar, Sergio Baez, Pablo Zazueta, Alejandra Pavez-Ovalle, Carolina Miquel, Juan Francisco Álvarez-Lobos, Manuel Int J Mol Sci Article Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/Vitamin D Receptor (VDR) gene variants. Blood samples were analyzed using Illumina’s Infinium Global Screening Array. The LCT-13910 CC genotype was found in 61% of IBD patients, similar to Chilean Hispanic controls and lower than Chilean Amerindian controls. The frequency of the LCT-13910-C allele in Chilean IBD patients (0.79) was comparable to the general population and higher than Europeans (0.49). Regarding VDR and VDD variants, in our study, the rs12785878-GG variant was associated with an increased risk of IBD (OR = 2.64, CI = 1.61–4.32; p-value = 0.001). Sixty-one percent of the Chilean IBD cohort have a genetic predisposition to lactose malabsorption, and a significant proportion exhibit genetic variants associated with VDD/VDR. Screening for LI and VDD is crucial in this Latin American IBD population. MDPI 2023-10-03 /pmc/articles/PMC10573577/ /pubmed/37834314 http://dx.doi.org/10.3390/ijms241914866 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Pérez-Jeldres, Tamara
Bustamante, M. Leonor
Segovia-Melero, Roberto
Aguilar, Nataly
Magne, Fabien
Ascui, Gabriel
Uribe, Denisse
Azócar, Lorena
Hernández-Rocha, Cristián
Estela, Ricardo
Silva, Verónica
De La Vega, Andrés
Arriagada, Elizabeth
Gonzalez, Mauricio
Onetto, Gian-Franco
Escobar, Sergio
Baez, Pablo
Zazueta, Alejandra
Pavez-Ovalle, Carolina
Miquel, Juan Francisco
Álvarez-Lobos, Manuel
Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title_full Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title_fullStr Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title_full_unstemmed Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title_short Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
title_sort genotype prevalence of lactose deficiency, vitamin d deficiency, and the vitamin d receptor in a chilean inflammatory bowel disease cohort: insights from an observational study
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573577/
https://www.ncbi.nlm.nih.gov/pubmed/37834314
http://dx.doi.org/10.3390/ijms241914866
work_keys_str_mv AT perezjeldrestamara genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT bustamantemleonor genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT segoviameleroroberto genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT aguilarnataly genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT magnefabien genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT ascuigabriel genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT uribedenisse genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT azocarlorena genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT hernandezrochacristian genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT estelaricardo genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT silvaveronica genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT delavegaandres genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT arriagadaelizabeth genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT gonzalezmauricio genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT onettogianfranco genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT escobarsergio genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT baezpablo genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT zazuetaalejandra genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT pavezovallecarolina genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT miqueljuanfrancisco genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy
AT alvarezlobosmanuel genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy