Cargando…
Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study
Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/...
Autores principales: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573577/ https://www.ncbi.nlm.nih.gov/pubmed/37834314 http://dx.doi.org/10.3390/ijms241914866 |
_version_ | 1785120496633774080 |
---|---|
author | Pérez-Jeldres, Tamara Bustamante, M. Leonor Segovia-Melero, Roberto Aguilar, Nataly Magne, Fabien Ascui, Gabriel Uribe, Denisse Azócar, Lorena Hernández-Rocha, Cristián Estela, Ricardo Silva, Verónica De La Vega, Andrés Arriagada, Elizabeth Gonzalez, Mauricio Onetto, Gian-Franco Escobar, Sergio Baez, Pablo Zazueta, Alejandra Pavez-Ovalle, Carolina Miquel, Juan Francisco Álvarez-Lobos, Manuel |
author_facet | Pérez-Jeldres, Tamara Bustamante, M. Leonor Segovia-Melero, Roberto Aguilar, Nataly Magne, Fabien Ascui, Gabriel Uribe, Denisse Azócar, Lorena Hernández-Rocha, Cristián Estela, Ricardo Silva, Verónica De La Vega, Andrés Arriagada, Elizabeth Gonzalez, Mauricio Onetto, Gian-Franco Escobar, Sergio Baez, Pablo Zazueta, Alejandra Pavez-Ovalle, Carolina Miquel, Juan Francisco Álvarez-Lobos, Manuel |
author_sort | Pérez-Jeldres, Tamara |
collection | PubMed |
description | Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/Vitamin D Receptor (VDR) gene variants. Blood samples were analyzed using Illumina’s Infinium Global Screening Array. The LCT-13910 CC genotype was found in 61% of IBD patients, similar to Chilean Hispanic controls and lower than Chilean Amerindian controls. The frequency of the LCT-13910-C allele in Chilean IBD patients (0.79) was comparable to the general population and higher than Europeans (0.49). Regarding VDR and VDD variants, in our study, the rs12785878-GG variant was associated with an increased risk of IBD (OR = 2.64, CI = 1.61–4.32; p-value = 0.001). Sixty-one percent of the Chilean IBD cohort have a genetic predisposition to lactose malabsorption, and a significant proportion exhibit genetic variants associated with VDD/VDR. Screening for LI and VDD is crucial in this Latin American IBD population. |
format | Online Article Text |
id | pubmed-10573577 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-105735772023-10-14 Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study Pérez-Jeldres, Tamara Bustamante, M. Leonor Segovia-Melero, Roberto Aguilar, Nataly Magne, Fabien Ascui, Gabriel Uribe, Denisse Azócar, Lorena Hernández-Rocha, Cristián Estela, Ricardo Silva, Verónica De La Vega, Andrés Arriagada, Elizabeth Gonzalez, Mauricio Onetto, Gian-Franco Escobar, Sergio Baez, Pablo Zazueta, Alejandra Pavez-Ovalle, Carolina Miquel, Juan Francisco Álvarez-Lobos, Manuel Int J Mol Sci Article Lactose intolerance (LI) and vitamin D deficiency (VDD) have been linked to inflammatory bowel disease (IBD). We conducted an observational study in 192 Chilean IBD patients to investigate the prevalence of a specific gene variant (LCT-13910 CC genotype) associated with LI and the prevalence of VDD/Vitamin D Receptor (VDR) gene variants. Blood samples were analyzed using Illumina’s Infinium Global Screening Array. The LCT-13910 CC genotype was found in 61% of IBD patients, similar to Chilean Hispanic controls and lower than Chilean Amerindian controls. The frequency of the LCT-13910-C allele in Chilean IBD patients (0.79) was comparable to the general population and higher than Europeans (0.49). Regarding VDR and VDD variants, in our study, the rs12785878-GG variant was associated with an increased risk of IBD (OR = 2.64, CI = 1.61–4.32; p-value = 0.001). Sixty-one percent of the Chilean IBD cohort have a genetic predisposition to lactose malabsorption, and a significant proportion exhibit genetic variants associated with VDD/VDR. Screening for LI and VDD is crucial in this Latin American IBD population. MDPI 2023-10-03 /pmc/articles/PMC10573577/ /pubmed/37834314 http://dx.doi.org/10.3390/ijms241914866 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Pérez-Jeldres, Tamara Bustamante, M. Leonor Segovia-Melero, Roberto Aguilar, Nataly Magne, Fabien Ascui, Gabriel Uribe, Denisse Azócar, Lorena Hernández-Rocha, Cristián Estela, Ricardo Silva, Verónica De La Vega, Andrés Arriagada, Elizabeth Gonzalez, Mauricio Onetto, Gian-Franco Escobar, Sergio Baez, Pablo Zazueta, Alejandra Pavez-Ovalle, Carolina Miquel, Juan Francisco Álvarez-Lobos, Manuel Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title | Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title_full | Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title_fullStr | Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title_full_unstemmed | Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title_short | Genotype Prevalence of Lactose Deficiency, Vitamin D Deficiency, and the Vitamin D Receptor in a Chilean Inflammatory Bowel Disease Cohort: Insights from an Observational Study |
title_sort | genotype prevalence of lactose deficiency, vitamin d deficiency, and the vitamin d receptor in a chilean inflammatory bowel disease cohort: insights from an observational study |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10573577/ https://www.ncbi.nlm.nih.gov/pubmed/37834314 http://dx.doi.org/10.3390/ijms241914866 |
work_keys_str_mv | AT perezjeldrestamara genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT bustamantemleonor genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT segoviameleroroberto genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT aguilarnataly genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT magnefabien genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT ascuigabriel genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT uribedenisse genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT azocarlorena genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT hernandezrochacristian genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT estelaricardo genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT silvaveronica genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT delavegaandres genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT arriagadaelizabeth genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT gonzalezmauricio genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT onettogianfranco genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT escobarsergio genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT baezpablo genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT zazuetaalejandra genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT pavezovallecarolina genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT miqueljuanfrancisco genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy AT alvarezlobosmanuel genotypeprevalenceoflactosedeficiencyvitaminddeficiencyandthevitamindreceptorinachileaninflammatoryboweldiseasecohortinsightsfromanobservationalstudy |