Cargando…

Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos

Chitin is the most abundant natural polymer in the oceans, where it is primarily recycled by chitin-degrading microorganisms. Endozoicomonadaceae (Oceanospirillales) bacteria are prominent symbionts of sessile marine animals, particularly corals, and presumably contribute to nutrient cycling in thei...

Descripción completa

Detalles Bibliográficos
Autores principales: da Silva, Daniela M. G., Pedrosa, Filipa R., Ângela Taipa, M., Costa, Rodrigo, Keller-Costa, Tina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10576748/
https://www.ncbi.nlm.nih.gov/pubmed/37838809
http://dx.doi.org/10.1038/s43705-023-00316-7
_version_ 1785121182057496576
author da Silva, Daniela M. G.
Pedrosa, Filipa R.
Ângela Taipa, M.
Costa, Rodrigo
Keller-Costa, Tina
author_facet da Silva, Daniela M. G.
Pedrosa, Filipa R.
Ângela Taipa, M.
Costa, Rodrigo
Keller-Costa, Tina
author_sort da Silva, Daniela M. G.
collection PubMed
description Chitin is the most abundant natural polymer in the oceans, where it is primarily recycled by chitin-degrading microorganisms. Endozoicomonadaceae (Oceanospirillales) bacteria are prominent symbionts of sessile marine animals, particularly corals, and presumably contribute to nutrient cycling in their hosts. To reveal the chitinolytic potential of this iconic, animal-dwelling bacterial family, we examined 42 publicly available genomes of cultured and uncultured Endozoicomonadaceae strains for the presence of chitinase-encoding genes. Thirty-two of 42 Endozoicomonadaceae genomes harbored endo-chitinase- (EC 3.2.1.14), 25 had exo-chitinase- (EC 3.2.1.52) and 23 polysaccharide deacetylase-encoding genes. Chitinases were present in cultured and uncultured Endozoicomonadaceae lineages associated with diverse marine animals, including the three formally described genera Endozoicomonas, Paraendozoicomonas and Kistimonas, the new genus Candidatus Gorgonimonas, and other, yet unclassified, groups of the family. Most endo-chitinases belonged to the glycoside hydrolase family GH18 but five GH19 endo-chitinases were also present. Many endo-chitinases harbored an active site and a signal peptide domain, indicating the enzymes are likely functional and exported to the extracellular environment where endo-chitinases usually act. Phylogenetic analysis revealed clade-specific diversification of endo-chitinases across the family. The presence of multiple, distinct endo-chitinases on the genomes of several Endozoicomonadaceae species hints at functional variation to secure effective chitin processing in diverse micro-niches and changing environmental conditions. We demonstrate that endo-chitinases and other genes involved in chitin degradation are widespread in the Endozoicomonadaceae family and posit that these symbionts play important roles in chitin turnover in filter- and suspension-feeding animals and in benthic, marine ecosystems at large.
format Online
Article
Text
id pubmed-10576748
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-105767482023-10-16 Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos da Silva, Daniela M. G. Pedrosa, Filipa R. Ângela Taipa, M. Costa, Rodrigo Keller-Costa, Tina ISME Commun Brief Communication Chitin is the most abundant natural polymer in the oceans, where it is primarily recycled by chitin-degrading microorganisms. Endozoicomonadaceae (Oceanospirillales) bacteria are prominent symbionts of sessile marine animals, particularly corals, and presumably contribute to nutrient cycling in their hosts. To reveal the chitinolytic potential of this iconic, animal-dwelling bacterial family, we examined 42 publicly available genomes of cultured and uncultured Endozoicomonadaceae strains for the presence of chitinase-encoding genes. Thirty-two of 42 Endozoicomonadaceae genomes harbored endo-chitinase- (EC 3.2.1.14), 25 had exo-chitinase- (EC 3.2.1.52) and 23 polysaccharide deacetylase-encoding genes. Chitinases were present in cultured and uncultured Endozoicomonadaceae lineages associated with diverse marine animals, including the three formally described genera Endozoicomonas, Paraendozoicomonas and Kistimonas, the new genus Candidatus Gorgonimonas, and other, yet unclassified, groups of the family. Most endo-chitinases belonged to the glycoside hydrolase family GH18 but five GH19 endo-chitinases were also present. Many endo-chitinases harbored an active site and a signal peptide domain, indicating the enzymes are likely functional and exported to the extracellular environment where endo-chitinases usually act. Phylogenetic analysis revealed clade-specific diversification of endo-chitinases across the family. The presence of multiple, distinct endo-chitinases on the genomes of several Endozoicomonadaceae species hints at functional variation to secure effective chitin processing in diverse micro-niches and changing environmental conditions. We demonstrate that endo-chitinases and other genes involved in chitin degradation are widespread in the Endozoicomonadaceae family and posit that these symbionts play important roles in chitin turnover in filter- and suspension-feeding animals and in benthic, marine ecosystems at large. Nature Publishing Group UK 2023-10-14 /pmc/articles/PMC10576748/ /pubmed/37838809 http://dx.doi.org/10.1038/s43705-023-00316-7 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Brief Communication
da Silva, Daniela M. G.
Pedrosa, Filipa R.
Ângela Taipa, M.
Costa, Rodrigo
Keller-Costa, Tina
Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title_full Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title_fullStr Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title_full_unstemmed Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title_short Widespread occurrence of chitinase-encoding genes suggests the Endozoicomonadaceae family as a key player in chitin processing in the marine benthos
title_sort widespread occurrence of chitinase-encoding genes suggests the endozoicomonadaceae family as a key player in chitin processing in the marine benthos
topic Brief Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10576748/
https://www.ncbi.nlm.nih.gov/pubmed/37838809
http://dx.doi.org/10.1038/s43705-023-00316-7
work_keys_str_mv AT dasilvadanielamg widespreadoccurrenceofchitinaseencodinggenessuggeststheendozoicomonadaceaefamilyasakeyplayerinchitinprocessinginthemarinebenthos
AT pedrosafilipar widespreadoccurrenceofchitinaseencodinggenessuggeststheendozoicomonadaceaefamilyasakeyplayerinchitinprocessinginthemarinebenthos
AT angelataipam widespreadoccurrenceofchitinaseencodinggenessuggeststheendozoicomonadaceaefamilyasakeyplayerinchitinprocessinginthemarinebenthos
AT costarodrigo widespreadoccurrenceofchitinaseencodinggenessuggeststheendozoicomonadaceaefamilyasakeyplayerinchitinprocessinginthemarinebenthos
AT kellercostatina widespreadoccurrenceofchitinaseencodinggenessuggeststheendozoicomonadaceaefamilyasakeyplayerinchitinprocessinginthemarinebenthos