Cargando…

Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis

Increasingly, non-pharmacological interventions are being identified and applied to post-stroke dysphagia. Nevertheless, there is insufficient evidence to assess which type of interventions are more effective. In this study, the randomized controlled trials of non-pharmacological interventions on po...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhu, Hao, Deng, Xinyuan, Luan, Guorui, Zhang, Yu, Wu, Yichen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10578008/
https://www.ncbi.nlm.nih.gov/pubmed/37845642
http://dx.doi.org/10.1186/s12868-023-00825-0
_version_ 1785121432320081920
author Zhu, Hao
Deng, Xinyuan
Luan, Guorui
Zhang, Yu
Wu, Yichen
author_facet Zhu, Hao
Deng, Xinyuan
Luan, Guorui
Zhang, Yu
Wu, Yichen
author_sort Zhu, Hao
collection PubMed
description Increasingly, non-pharmacological interventions are being identified and applied to post-stroke dysphagia. Nevertheless, there is insufficient evidence to assess which type of interventions are more effective. In this study, the randomized controlled trials of non-pharmacological interventions on post-stroke dysphagia were retrieved from the relevant databases. Including 96 studies and 12 non-drug treatments. Then, and the network meta-analysis is carried out by statistical software. The results show: In the aspects of videofluoroscopic swallowing study (VFSS), Standardized Swallowing Assessment (SSA), swallowing-quality of life (SWAL-QOL), Water swallow test (WST); Acupuncture + electrotherapy + rehabilitation training, acupuncture + rehabilitation training + massage, electrotherapy + rehabilitation training, acupuncture + electrotherapy + rehabilitation training, electrotherapy, acupuncture + rehabilitation training + acupoints sticking application have significant effects in post-stroke dysphagia. Compared with other interventions, they have more advantages in improving the above indicators. A substantial number of high-quality randomized clinical trials are still necessary in the prospective to validate the therapeutic effectiveness of non-pharmacological interventions in post-stroke dysphagia and the results of this Bayesian network meta-analysis. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12868-023-00825-0.
format Online
Article
Text
id pubmed-10578008
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-105780082023-10-17 Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis Zhu, Hao Deng, Xinyuan Luan, Guorui Zhang, Yu Wu, Yichen BMC Neurosci Review Increasingly, non-pharmacological interventions are being identified and applied to post-stroke dysphagia. Nevertheless, there is insufficient evidence to assess which type of interventions are more effective. In this study, the randomized controlled trials of non-pharmacological interventions on post-stroke dysphagia were retrieved from the relevant databases. Including 96 studies and 12 non-drug treatments. Then, and the network meta-analysis is carried out by statistical software. The results show: In the aspects of videofluoroscopic swallowing study (VFSS), Standardized Swallowing Assessment (SSA), swallowing-quality of life (SWAL-QOL), Water swallow test (WST); Acupuncture + electrotherapy + rehabilitation training, acupuncture + rehabilitation training + massage, electrotherapy + rehabilitation training, acupuncture + electrotherapy + rehabilitation training, electrotherapy, acupuncture + rehabilitation training + acupoints sticking application have significant effects in post-stroke dysphagia. Compared with other interventions, they have more advantages in improving the above indicators. A substantial number of high-quality randomized clinical trials are still necessary in the prospective to validate the therapeutic effectiveness of non-pharmacological interventions in post-stroke dysphagia and the results of this Bayesian network meta-analysis. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12868-023-00825-0. BioMed Central 2023-10-16 /pmc/articles/PMC10578008/ /pubmed/37845642 http://dx.doi.org/10.1186/s12868-023-00825-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Zhu, Hao
Deng, Xinyuan
Luan, Guorui
Zhang, Yu
Wu, Yichen
Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title_full Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title_fullStr Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title_full_unstemmed Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title_short Comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and Bayesian network meta-analysis
title_sort comparison of efficacy of non-pharmacological intervention for post-stroke dysphagia: a systematic review and bayesian network meta-analysis
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10578008/
https://www.ncbi.nlm.nih.gov/pubmed/37845642
http://dx.doi.org/10.1186/s12868-023-00825-0
work_keys_str_mv AT zhuhao comparisonofefficacyofnonpharmacologicalinterventionforpoststrokedysphagiaasystematicreviewandbayesiannetworkmetaanalysis
AT dengxinyuan comparisonofefficacyofnonpharmacologicalinterventionforpoststrokedysphagiaasystematicreviewandbayesiannetworkmetaanalysis
AT luanguorui comparisonofefficacyofnonpharmacologicalinterventionforpoststrokedysphagiaasystematicreviewandbayesiannetworkmetaanalysis
AT zhangyu comparisonofefficacyofnonpharmacologicalinterventionforpoststrokedysphagiaasystematicreviewandbayesiannetworkmetaanalysis
AT wuyichen comparisonofefficacyofnonpharmacologicalinterventionforpoststrokedysphagiaasystematicreviewandbayesiannetworkmetaanalysis