Cargando…
IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis
PURPOSE: To explore the mechanism underlying IL-8-induced neutrophil extracellular trap (NET) formation in patients with ocular-active Behçet's disease (BD) and the effect of inhibiting NET formation on the severity of inflammation in experimental autoimmune uveitis (EAU) mice. METHODS: The ser...
Autores principales: | , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Association for Research in Vision and Ophthalmology
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10587853/ https://www.ncbi.nlm.nih.gov/pubmed/37824136 http://dx.doi.org/10.1167/iovs.64.13.19 |
_version_ | 1785123453425156096 |
---|---|
author | Shu, Qinxin Zhang, Ni Liu, Yanyao Wang, Xing Chen, Jinquan Xie, Hao Pan, Fuying Zhao, Long Ding, Xuanheng Wen, Yan Wang, Lingda Xie, Wenxi Lu, Jing Su, Guannan Peng, Hui Yang, Peizeng |
author_facet | Shu, Qinxin Zhang, Ni Liu, Yanyao Wang, Xing Chen, Jinquan Xie, Hao Pan, Fuying Zhao, Long Ding, Xuanheng Wen, Yan Wang, Lingda Xie, Wenxi Lu, Jing Su, Guannan Peng, Hui Yang, Peizeng |
author_sort | Shu, Qinxin |
collection | PubMed |
description | PURPOSE: To explore the mechanism underlying IL-8-induced neutrophil extracellular trap (NET) formation in patients with ocular-active Behçet's disease (BD) and the effect of inhibiting NET formation on the severity of inflammation in experimental autoimmune uveitis (EAU) mice. METHODS: The serum extracellular DNA and neutrophil elastase (NE) and IL-8 levels in patients with ocular-active BD, the expression of myeloperoxidase, NE, and histone H3Cit in IL-8–induced neutrophils isolated from healthy controls, and the effects of NETs on HMC3 cells were detected. Female C57BL/6J mice were immunized with IRBP651–670 to induce EAU and EAU mice received intravitreal injection of the CXCR2 (IL-8 receptor) antagonist SB225002 or PBS. The serum levels of extracellular DNA, NE, and keratinocyte-derived chemokine (the mouse ortholog of human IL-8) and expression of myeloperoxidase, NE, and histone H3Cit in mouse retinas were detected. Disease severity was evaluated by clinical and histopathological scores. RESULTS: Serum keratinocyte-derived chemokine expression levels in EAU mice and IL-8 expression levels in patients with ocular-active BD increased. IL-8 notably increased NET formation in a dose-dependent manner through an nicotinamide adenine dinucleotide phosphate oxidase and mitogen-activated protein kinase pathway dependent mechanism. IL-8–induced NET formation damaged HMC3 cells in vitro. Pretreatment with SB225002 notably ameliorated the production of NETs in EAU mice. CONCLUSIONS: Our data confirm that NET formation is induced by IL-8. IL-8–induced NET formation was found to be related to mitogen-activated protein kinase and nicotinamide adenine dinucleotide phosphate pathways. Pretreatment with the CXCR2 antagonist SB225002 alleviated neutrophil infiltration and suppressed NET formation in EAU mice. |
format | Online Article Text |
id | pubmed-10587853 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | The Association for Research in Vision and Ophthalmology |
record_format | MEDLINE/PubMed |
spelling | pubmed-105878532023-10-21 IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis Shu, Qinxin Zhang, Ni Liu, Yanyao Wang, Xing Chen, Jinquan Xie, Hao Pan, Fuying Zhao, Long Ding, Xuanheng Wen, Yan Wang, Lingda Xie, Wenxi Lu, Jing Su, Guannan Peng, Hui Yang, Peizeng Invest Ophthalmol Vis Sci Immunology and Microbiology PURPOSE: To explore the mechanism underlying IL-8-induced neutrophil extracellular trap (NET) formation in patients with ocular-active Behçet's disease (BD) and the effect of inhibiting NET formation on the severity of inflammation in experimental autoimmune uveitis (EAU) mice. METHODS: The serum extracellular DNA and neutrophil elastase (NE) and IL-8 levels in patients with ocular-active BD, the expression of myeloperoxidase, NE, and histone H3Cit in IL-8–induced neutrophils isolated from healthy controls, and the effects of NETs on HMC3 cells were detected. Female C57BL/6J mice were immunized with IRBP651–670 to induce EAU and EAU mice received intravitreal injection of the CXCR2 (IL-8 receptor) antagonist SB225002 or PBS. The serum levels of extracellular DNA, NE, and keratinocyte-derived chemokine (the mouse ortholog of human IL-8) and expression of myeloperoxidase, NE, and histone H3Cit in mouse retinas were detected. Disease severity was evaluated by clinical and histopathological scores. RESULTS: Serum keratinocyte-derived chemokine expression levels in EAU mice and IL-8 expression levels in patients with ocular-active BD increased. IL-8 notably increased NET formation in a dose-dependent manner through an nicotinamide adenine dinucleotide phosphate oxidase and mitogen-activated protein kinase pathway dependent mechanism. IL-8–induced NET formation damaged HMC3 cells in vitro. Pretreatment with SB225002 notably ameliorated the production of NETs in EAU mice. CONCLUSIONS: Our data confirm that NET formation is induced by IL-8. IL-8–induced NET formation was found to be related to mitogen-activated protein kinase and nicotinamide adenine dinucleotide phosphate pathways. Pretreatment with the CXCR2 antagonist SB225002 alleviated neutrophil infiltration and suppressed NET formation in EAU mice. The Association for Research in Vision and Ophthalmology 2023-10-12 /pmc/articles/PMC10587853/ /pubmed/37824136 http://dx.doi.org/10.1167/iovs.64.13.19 Text en Copyright 2023 The Authors https://creativecommons.org/licenses/by-nc-nd/4.0/This work is licensed under a Creative Commons Attribution-NonCommercial-NoDerivatives 4.0 International License. |
spellingShingle | Immunology and Microbiology Shu, Qinxin Zhang, Ni Liu, Yanyao Wang, Xing Chen, Jinquan Xie, Hao Pan, Fuying Zhao, Long Ding, Xuanheng Wen, Yan Wang, Lingda Xie, Wenxi Lu, Jing Su, Guannan Peng, Hui Yang, Peizeng IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title | IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title_full | IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title_fullStr | IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title_full_unstemmed | IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title_short | IL-8 Triggers Neutrophil Extracellular Trap Formation Through an Nicotinamide Adenine Dinucleotide Phosphate Oxidase- and Mitogen-Activated Protein Kinase Pathway-Dependent Mechanism in Uveitis |
title_sort | il-8 triggers neutrophil extracellular trap formation through an nicotinamide adenine dinucleotide phosphate oxidase- and mitogen-activated protein kinase pathway-dependent mechanism in uveitis |
topic | Immunology and Microbiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10587853/ https://www.ncbi.nlm.nih.gov/pubmed/37824136 http://dx.doi.org/10.1167/iovs.64.13.19 |
work_keys_str_mv | AT shuqinxin il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT zhangni il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT liuyanyao il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT wangxing il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT chenjinquan il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT xiehao il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT panfuying il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT zhaolong il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT dingxuanheng il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT wenyan il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT wanglingda il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT xiewenxi il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT lujing il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT suguannan il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT penghui il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis AT yangpeizeng il8triggersneutrophilextracellulartrapformationthroughannicotinamideadeninedinucleotidephosphateoxidaseandmitogenactivatedproteinkinasepathwaydependentmechanisminuveitis |