Cargando…
Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review
BACKGROUND: Migrants are known to be an under-immunised group for many routine vaccinations. We did a global systematic review to explore and assess factors that influence uptake of vaccines for human papillomavirus (HPV) infection, using the WHO-endorsed Behavioural and Social Driver of Vaccination...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10596746/ http://dx.doi.org/10.1093/eurpub/ckad160.1630 |
_version_ | 1785125176954847232 |
---|---|
author | Mansour, R Razai, M Hargreaves, S |
author_facet | Mansour, R Razai, M Hargreaves, S |
author_sort | Mansour, R |
collection | PubMed |
description | BACKGROUND: Migrants are known to be an under-immunised group for many routine vaccinations. We did a global systematic review to explore and assess factors that influence uptake of vaccines for human papillomavirus (HPV) infection, using the WHO-endorsed Behavioural and Social Driver of Vaccination Framework (BeSD). METHODS: Using PRISMA guidelines, 3,075 records were found from 7 databases (2006-2023), with no exclusions based on country or language. After title/abstract screening and full-text review, data were extracted for thematic analysis using BeSD (4 domains for vaccine behavioural change) and qualitative synthesis. RESULTS: We included 104 studies from 16 countries: two thirds from the US, 25% from Europe, and only 2% from LMICs. The majority focused on vaccine eligibility and/or parents; 10% looked at providers’ views; 2% involved wider stakeholders, and most research focused on females. Migrant sub-groups reported diverse views and experiences about HPV vaccines. Many examined vaccine initiation and identified low awareness/knowledge of HPV/HPV vaccine. “What people think/feel” domain: barriers such as concerns on vaccine safety, cultural belief, lack of information, vaccine unnecessary; mixed view on vaccine benefit. “Social process”: doctor recommendation and information via providers/peers was influential but depended on framing and migrant characteristics. “Motivation” domain was understudied. “Practical issues” that impact uptake included cost, mobility, accessibility, and language. CONCLUSIONS: Culturally sensitive education to address misconception and enhance importance of HPV vaccines were considered important, alaongside practical efforts to address mobility (mHealth), proactive vaccine behaviour and strong provider recommendation. A comprehensive strategy along the BeSD pathway, using a multipronged approach, would be valuable, and may be further enhanced by exploring wider macro-level factors. KEY MESSAGES: • Special efforts will be needed to engage mobile groups in HPV vaccination, with further research needed in LMICs. • Culturally sensitive education to address misconception and enhance importance of HPV vaccines were considered important. |
format | Online Article Text |
id | pubmed-10596746 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-105967462023-10-25 Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review Mansour, R Razai, M Hargreaves, S Eur J Public Health Poster Displays BACKGROUND: Migrants are known to be an under-immunised group for many routine vaccinations. We did a global systematic review to explore and assess factors that influence uptake of vaccines for human papillomavirus (HPV) infection, using the WHO-endorsed Behavioural and Social Driver of Vaccination Framework (BeSD). METHODS: Using PRISMA guidelines, 3,075 records were found from 7 databases (2006-2023), with no exclusions based on country or language. After title/abstract screening and full-text review, data were extracted for thematic analysis using BeSD (4 domains for vaccine behavioural change) and qualitative synthesis. RESULTS: We included 104 studies from 16 countries: two thirds from the US, 25% from Europe, and only 2% from LMICs. The majority focused on vaccine eligibility and/or parents; 10% looked at providers’ views; 2% involved wider stakeholders, and most research focused on females. Migrant sub-groups reported diverse views and experiences about HPV vaccines. Many examined vaccine initiation and identified low awareness/knowledge of HPV/HPV vaccine. “What people think/feel” domain: barriers such as concerns on vaccine safety, cultural belief, lack of information, vaccine unnecessary; mixed view on vaccine benefit. “Social process”: doctor recommendation and information via providers/peers was influential but depended on framing and migrant characteristics. “Motivation” domain was understudied. “Practical issues” that impact uptake included cost, mobility, accessibility, and language. CONCLUSIONS: Culturally sensitive education to address misconception and enhance importance of HPV vaccines were considered important, alaongside practical efforts to address mobility (mHealth), proactive vaccine behaviour and strong provider recommendation. A comprehensive strategy along the BeSD pathway, using a multipronged approach, would be valuable, and may be further enhanced by exploring wider macro-level factors. KEY MESSAGES: • Special efforts will be needed to engage mobile groups in HPV vaccination, with further research needed in LMICs. • Culturally sensitive education to address misconception and enhance importance of HPV vaccines were considered important. Oxford University Press 2023-10-24 /pmc/articles/PMC10596746/ http://dx.doi.org/10.1093/eurpub/ckad160.1630 Text en © The Author(s) 2023. Published by Oxford University Press on behalf of the European Public Health Association. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (https://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com |
spellingShingle | Poster Displays Mansour, R Razai, M Hargreaves, S Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title | Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title_full | Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title_fullStr | Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title_full_unstemmed | Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title_short | Factors that influence the uptake and delivery of HPV vaccines in migrants: a systematic review |
title_sort | factors that influence the uptake and delivery of hpv vaccines in migrants: a systematic review |
topic | Poster Displays |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10596746/ http://dx.doi.org/10.1093/eurpub/ckad160.1630 |
work_keys_str_mv | AT mansourr factorsthatinfluencetheuptakeanddeliveryofhpvvaccinesinmigrantsasystematicreview AT razaim factorsthatinfluencetheuptakeanddeliveryofhpvvaccinesinmigrantsasystematicreview AT hargreavess factorsthatinfluencetheuptakeanddeliveryofhpvvaccinesinmigrantsasystematicreview |