Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus

Takifugu fasciatus is an aquaculture species with high economic value. In recent years, problems such as environmental pollution and inbreeding have caused a serious decline in T. fasciatus germplasm resources. In this study, a high-density genetic linkage map was constructed by whole-genome reseque...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Ying, Li, Jie, Chu, Peng, Shang, Ruhua, Yin, Shaowu, Wang, Tao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Research
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10604518/
https://www.ncbi.nlm.nih.gov/pubmed/37891474
http://dx.doi.org/10.1186/s12864-023-09740-4
_version_ 1785126854106021888
author Zhang, Ying
Li, Jie
Chu, Peng
Shang, Ruhua
Yin, Shaowu
Wang, Tao
author_facet Zhang, Ying
Li, Jie
Chu, Peng
Shang, Ruhua
Yin, Shaowu
Wang, Tao
author_sort Zhang, Ying
collection PubMed
description Takifugu fasciatus is an aquaculture species with high economic value. In recent years, problems such as environmental pollution and inbreeding have caused a serious decline in T. fasciatus germplasm resources. In this study, a high-density genetic linkage map was constructed by whole-genome resequencing. The map consists of 4891 bin markers distributed across 22 linkage groups (LGs), with a total genetic coverage of 2381.353 cM and a mean density of 0.535 cM. Quantitative trait locus (QTL) localization analysis showed that a total of 19 QTLs associated with growth traits of T. fasciatus in the genome-wide significance threshold range, distributed on 11 LGs. In addition, 11 QTLs associated with cold tolerance traits were identified, each scattered on a different LG. Furthermore, we used QTL localization analysis to screen out three candidate genes (IGF1, IGF2, ADGRB) related to growth in T. fasciatus. Meanwhile, we screened three candidate genes (HSP90, HSP70, and HMGB1) related to T. fasciatus cold tolerance. Our study can provide a theoretical basis for the selection and breeding of cold-tolerant or fast-growing T. fasciatus. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12864-023-09740-4.
format Online
Article
Text
id pubmed-10604518
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-106045182023-10-28 Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus Zhang, Ying Li, Jie Chu, Peng Shang, Ruhua Yin, Shaowu Wang, Tao BMC Genomics Research Takifugu fasciatus is an aquaculture species with high economic value. In recent years, problems such as environmental pollution and inbreeding have caused a serious decline in T. fasciatus germplasm resources. In this study, a high-density genetic linkage map was constructed by whole-genome resequencing. The map consists of 4891 bin markers distributed across 22 linkage groups (LGs), with a total genetic coverage of 2381.353 cM and a mean density of 0.535 cM. Quantitative trait locus (QTL) localization analysis showed that a total of 19 QTLs associated with growth traits of T. fasciatus in the genome-wide significance threshold range, distributed on 11 LGs. In addition, 11 QTLs associated with cold tolerance traits were identified, each scattered on a different LG. Furthermore, we used QTL localization analysis to screen out three candidate genes (IGF1, IGF2, ADGRB) related to growth in T. fasciatus. Meanwhile, we screened three candidate genes (HSP90, HSP70, and HMGB1) related to T. fasciatus cold tolerance. Our study can provide a theoretical basis for the selection and breeding of cold-tolerant or fast-growing T. fasciatus. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12864-023-09740-4. BioMed Central 2023-10-27 /pmc/articles/PMC10604518/ /pubmed/37891474 http://dx.doi.org/10.1186/s12864-023-09740-4 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Zhang, Ying
Li, Jie
Chu, Peng
Shang, Ruhua
Yin, Shaowu
Wang, Tao
Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title_full Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title_fullStr Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title_full_unstemmed Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title_short Construction of a high-density genetic linkage map and QTL mapping of growth and cold tolerance traits in Takifugu fasciatus
title_sort construction of a high-density genetic linkage map and qtl mapping of growth and cold tolerance traits in takifugu fasciatus
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10604518/
https://www.ncbi.nlm.nih.gov/pubmed/37891474
http://dx.doi.org/10.1186/s12864-023-09740-4
work_keys_str_mv AT zhangying constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus
AT lijie constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus
AT chupeng constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus
AT shangruhua constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus
AT yinshaowu constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus
AT wangtao constructionofahighdensitygeneticlinkagemapandqtlmappingofgrowthandcoldtolerancetraitsintakifugufasciatus

Ejemplares similares