Cargando…

Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review

Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will...

Descripción completa

Detalles Bibliográficos
Autores principales: Tsuge, Mitsuru, Uda, Kazuhiro, Eitoku, Takahiro, Matsumoto, Naomi, Yorifuji, Takashi, Tsukahara, Hirokazu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10607378/
https://www.ncbi.nlm.nih.gov/pubmed/37895129
http://dx.doi.org/10.3390/ijms242015450
_version_ 1785127532371116032
author Tsuge, Mitsuru
Uda, Kazuhiro
Eitoku, Takahiro
Matsumoto, Naomi
Yorifuji, Takashi
Tsukahara, Hirokazu
author_facet Tsuge, Mitsuru
Uda, Kazuhiro
Eitoku, Takahiro
Matsumoto, Naomi
Yorifuji, Takashi
Tsukahara, Hirokazu
author_sort Tsuge, Mitsuru
collection PubMed
description Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will be at risk of clinical cardiovascular events and even sudden death. The etiology of KD remains unclear; however, it may involve both genetic and environmental factors leading to aberrant inflammatory responses. Given the young age of onset, prenatal or perinatal exposure may be etiologically relevant. Multisystem inflammatory syndrome in children, a post-infectious hyper-inflammatory disorder associated with severe acute respiratory syndrome coronavirus 2, has features that overlap with those of KD. Available evidence indicates that vascular endothelial dysfunction is a critical step in the sequence of events leading to the development of cardiovascular lesions in KD. Oxidative stress and the dysregulation of the nitric oxide (NO) system contribute to the pathogenesis of inflammatory responses related to this disease. This review provides current evidence and concepts highlighting the adverse effects of oxidative injury and NO system derangements on the initiation and progression of KD and potential therapeutic strategies for cardiovascular pathologies in affected children.
format Online
Article
Text
id pubmed-10607378
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-106073782023-10-28 Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review Tsuge, Mitsuru Uda, Kazuhiro Eitoku, Takahiro Matsumoto, Naomi Yorifuji, Takashi Tsukahara, Hirokazu Int J Mol Sci Review Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will be at risk of clinical cardiovascular events and even sudden death. The etiology of KD remains unclear; however, it may involve both genetic and environmental factors leading to aberrant inflammatory responses. Given the young age of onset, prenatal or perinatal exposure may be etiologically relevant. Multisystem inflammatory syndrome in children, a post-infectious hyper-inflammatory disorder associated with severe acute respiratory syndrome coronavirus 2, has features that overlap with those of KD. Available evidence indicates that vascular endothelial dysfunction is a critical step in the sequence of events leading to the development of cardiovascular lesions in KD. Oxidative stress and the dysregulation of the nitric oxide (NO) system contribute to the pathogenesis of inflammatory responses related to this disease. This review provides current evidence and concepts highlighting the adverse effects of oxidative injury and NO system derangements on the initiation and progression of KD and potential therapeutic strategies for cardiovascular pathologies in affected children. MDPI 2023-10-22 /pmc/articles/PMC10607378/ /pubmed/37895129 http://dx.doi.org/10.3390/ijms242015450 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Tsuge, Mitsuru
Uda, Kazuhiro
Eitoku, Takahiro
Matsumoto, Naomi
Yorifuji, Takashi
Tsukahara, Hirokazu
Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title_full Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title_fullStr Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title_full_unstemmed Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title_short Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
title_sort roles of oxidative injury and nitric oxide system derangements in kawasaki disease pathogenesis: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10607378/
https://www.ncbi.nlm.nih.gov/pubmed/37895129
http://dx.doi.org/10.3390/ijms242015450
work_keys_str_mv AT tsugemitsuru rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview
AT udakazuhiro rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview
AT eitokutakahiro rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview
AT matsumotonaomi rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview
AT yorifujitakashi rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview
AT tsukaharahirokazu rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview