Cargando…
Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review
Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10607378/ https://www.ncbi.nlm.nih.gov/pubmed/37895129 http://dx.doi.org/10.3390/ijms242015450 |
_version_ | 1785127532371116032 |
---|---|
author | Tsuge, Mitsuru Uda, Kazuhiro Eitoku, Takahiro Matsumoto, Naomi Yorifuji, Takashi Tsukahara, Hirokazu |
author_facet | Tsuge, Mitsuru Uda, Kazuhiro Eitoku, Takahiro Matsumoto, Naomi Yorifuji, Takashi Tsukahara, Hirokazu |
author_sort | Tsuge, Mitsuru |
collection | PubMed |
description | Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will be at risk of clinical cardiovascular events and even sudden death. The etiology of KD remains unclear; however, it may involve both genetic and environmental factors leading to aberrant inflammatory responses. Given the young age of onset, prenatal or perinatal exposure may be etiologically relevant. Multisystem inflammatory syndrome in children, a post-infectious hyper-inflammatory disorder associated with severe acute respiratory syndrome coronavirus 2, has features that overlap with those of KD. Available evidence indicates that vascular endothelial dysfunction is a critical step in the sequence of events leading to the development of cardiovascular lesions in KD. Oxidative stress and the dysregulation of the nitric oxide (NO) system contribute to the pathogenesis of inflammatory responses related to this disease. This review provides current evidence and concepts highlighting the adverse effects of oxidative injury and NO system derangements on the initiation and progression of KD and potential therapeutic strategies for cardiovascular pathologies in affected children. |
format | Online Article Text |
id | pubmed-10607378 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-106073782023-10-28 Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review Tsuge, Mitsuru Uda, Kazuhiro Eitoku, Takahiro Matsumoto, Naomi Yorifuji, Takashi Tsukahara, Hirokazu Int J Mol Sci Review Kawasaki disease (KD) is an acute febrile vasculitis that occurs mostly in children younger than five years. KD involves multiple intricately connected inflammatory reactions activated by a cytokine cascade. Despite therapeutic advances, coronary artery damage may develop in some patients, who will be at risk of clinical cardiovascular events and even sudden death. The etiology of KD remains unclear; however, it may involve both genetic and environmental factors leading to aberrant inflammatory responses. Given the young age of onset, prenatal or perinatal exposure may be etiologically relevant. Multisystem inflammatory syndrome in children, a post-infectious hyper-inflammatory disorder associated with severe acute respiratory syndrome coronavirus 2, has features that overlap with those of KD. Available evidence indicates that vascular endothelial dysfunction is a critical step in the sequence of events leading to the development of cardiovascular lesions in KD. Oxidative stress and the dysregulation of the nitric oxide (NO) system contribute to the pathogenesis of inflammatory responses related to this disease. This review provides current evidence and concepts highlighting the adverse effects of oxidative injury and NO system derangements on the initiation and progression of KD and potential therapeutic strategies for cardiovascular pathologies in affected children. MDPI 2023-10-22 /pmc/articles/PMC10607378/ /pubmed/37895129 http://dx.doi.org/10.3390/ijms242015450 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Tsuge, Mitsuru Uda, Kazuhiro Eitoku, Takahiro Matsumoto, Naomi Yorifuji, Takashi Tsukahara, Hirokazu Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title | Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title_full | Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title_fullStr | Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title_full_unstemmed | Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title_short | Roles of Oxidative Injury and Nitric Oxide System Derangements in Kawasaki Disease Pathogenesis: A Systematic Review |
title_sort | roles of oxidative injury and nitric oxide system derangements in kawasaki disease pathogenesis: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10607378/ https://www.ncbi.nlm.nih.gov/pubmed/37895129 http://dx.doi.org/10.3390/ijms242015450 |
work_keys_str_mv | AT tsugemitsuru rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview AT udakazuhiro rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview AT eitokutakahiro rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview AT matsumotonaomi rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview AT yorifujitakashi rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview AT tsukaharahirokazu rolesofoxidativeinjuryandnitricoxidesystemderangementsinkawasakidiseasepathogenesisasystematicreview |