Cargando…
Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and k...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10611265/ https://www.ncbi.nlm.nih.gov/pubmed/37896864 http://dx.doi.org/10.3390/v15102087 |
_version_ | 1785128450835611648 |
---|---|
author | Pennisi, Maria Grazia Belák, Sándor Tasker, Séverine Addie, Diane D. Boucraut-Baralon, Corine Egberink, Herman Frymus, Tadeusz Hartmann, Katrin Hofmann-Lehmann, Regina Lloret, Albert Marsilio, Fulvio Thiry, Etienne Truyen, Uwe Möstl, Karin Hosie, Margaret J. |
author_facet | Pennisi, Maria Grazia Belák, Sándor Tasker, Séverine Addie, Diane D. Boucraut-Baralon, Corine Egberink, Herman Frymus, Tadeusz Hartmann, Katrin Hofmann-Lehmann, Regina Lloret, Albert Marsilio, Fulvio Thiry, Etienne Truyen, Uwe Möstl, Karin Hosie, Margaret J. |
author_sort | Pennisi, Maria Grazia |
collection | PubMed |
description | Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and kidney tissues. The viral genetic diversity of FeMV is extensive, but it is not known if this is clinically relevant. Urine and kidney tissues have been widely tested in attempts to confirm associations between FeMV infection and renal disease, but samples from both healthy and sick cats can test positive and some cross-sectional studies have not found associations between FeMV infection and CKD. There is also evidence for acute kidney injury following infection with FeMV. The results of prevalence studies differ greatly depending on the population tested and methodologies used for detection, but worldwide distribution of FeMV has been shown. Experimental studies have confirmed previous field observations that higher viral loads are present in the urine compared to other tissues, and renal TIN lesions associated with FeMV antigen have been demonstrated, alongside virus lymphotropism and viraemia-associated lymphopenia. Longitudinal field studies have revealed persistent viral shedding in urine, although infection can be cleared spontaneously. |
format | Online Article Text |
id | pubmed-10611265 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-106112652023-10-28 Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats Pennisi, Maria Grazia Belák, Sándor Tasker, Séverine Addie, Diane D. Boucraut-Baralon, Corine Egberink, Herman Frymus, Tadeusz Hartmann, Katrin Hofmann-Lehmann, Regina Lloret, Albert Marsilio, Fulvio Thiry, Etienne Truyen, Uwe Möstl, Karin Hosie, Margaret J. Viruses Review Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and kidney tissues. The viral genetic diversity of FeMV is extensive, but it is not known if this is clinically relevant. Urine and kidney tissues have been widely tested in attempts to confirm associations between FeMV infection and renal disease, but samples from both healthy and sick cats can test positive and some cross-sectional studies have not found associations between FeMV infection and CKD. There is also evidence for acute kidney injury following infection with FeMV. The results of prevalence studies differ greatly depending on the population tested and methodologies used for detection, but worldwide distribution of FeMV has been shown. Experimental studies have confirmed previous field observations that higher viral loads are present in the urine compared to other tissues, and renal TIN lesions associated with FeMV antigen have been demonstrated, alongside virus lymphotropism and viraemia-associated lymphopenia. Longitudinal field studies have revealed persistent viral shedding in urine, although infection can be cleared spontaneously. MDPI 2023-10-13 /pmc/articles/PMC10611265/ /pubmed/37896864 http://dx.doi.org/10.3390/v15102087 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Pennisi, Maria Grazia Belák, Sándor Tasker, Séverine Addie, Diane D. Boucraut-Baralon, Corine Egberink, Herman Frymus, Tadeusz Hartmann, Katrin Hofmann-Lehmann, Regina Lloret, Albert Marsilio, Fulvio Thiry, Etienne Truyen, Uwe Möstl, Karin Hosie, Margaret J. Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title | Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title_full | Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title_fullStr | Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title_full_unstemmed | Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title_short | Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats |
title_sort | feline morbillivirus: clinical relevance of a widespread endemic viral infection of cats |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10611265/ https://www.ncbi.nlm.nih.gov/pubmed/37896864 http://dx.doi.org/10.3390/v15102087 |
work_keys_str_mv | AT pennisimariagrazia felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT belaksandor felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT taskerseverine felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT addiedianed felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT boucrautbaraloncorine felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT egberinkherman felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT frymustadeusz felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT hartmannkatrin felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT hofmannlehmannregina felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT lloretalbert felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT marsiliofulvio felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT thiryetienne felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT truyenuwe felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT mostlkarin felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats AT hosiemargaretj felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats |