Cargando…

Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats

Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and k...

Descripción completa

Detalles Bibliográficos
Autores principales: Pennisi, Maria Grazia, Belák, Sándor, Tasker, Séverine, Addie, Diane D., Boucraut-Baralon, Corine, Egberink, Herman, Frymus, Tadeusz, Hartmann, Katrin, Hofmann-Lehmann, Regina, Lloret, Albert, Marsilio, Fulvio, Thiry, Etienne, Truyen, Uwe, Möstl, Karin, Hosie, Margaret J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10611265/
https://www.ncbi.nlm.nih.gov/pubmed/37896864
http://dx.doi.org/10.3390/v15102087
_version_ 1785128450835611648
author Pennisi, Maria Grazia
Belák, Sándor
Tasker, Séverine
Addie, Diane D.
Boucraut-Baralon, Corine
Egberink, Herman
Frymus, Tadeusz
Hartmann, Katrin
Hofmann-Lehmann, Regina
Lloret, Albert
Marsilio, Fulvio
Thiry, Etienne
Truyen, Uwe
Möstl, Karin
Hosie, Margaret J.
author_facet Pennisi, Maria Grazia
Belák, Sándor
Tasker, Séverine
Addie, Diane D.
Boucraut-Baralon, Corine
Egberink, Herman
Frymus, Tadeusz
Hartmann, Katrin
Hofmann-Lehmann, Regina
Lloret, Albert
Marsilio, Fulvio
Thiry, Etienne
Truyen, Uwe
Möstl, Karin
Hosie, Margaret J.
author_sort Pennisi, Maria Grazia
collection PubMed
description Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and kidney tissues. The viral genetic diversity of FeMV is extensive, but it is not known if this is clinically relevant. Urine and kidney tissues have been widely tested in attempts to confirm associations between FeMV infection and renal disease, but samples from both healthy and sick cats can test positive and some cross-sectional studies have not found associations between FeMV infection and CKD. There is also evidence for acute kidney injury following infection with FeMV. The results of prevalence studies differ greatly depending on the population tested and methodologies used for detection, but worldwide distribution of FeMV has been shown. Experimental studies have confirmed previous field observations that higher viral loads are present in the urine compared to other tissues, and renal TIN lesions associated with FeMV antigen have been demonstrated, alongside virus lymphotropism and viraemia-associated lymphopenia. Longitudinal field studies have revealed persistent viral shedding in urine, although infection can be cleared spontaneously.
format Online
Article
Text
id pubmed-10611265
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-106112652023-10-28 Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats Pennisi, Maria Grazia Belák, Sándor Tasker, Séverine Addie, Diane D. Boucraut-Baralon, Corine Egberink, Herman Frymus, Tadeusz Hartmann, Katrin Hofmann-Lehmann, Regina Lloret, Albert Marsilio, Fulvio Thiry, Etienne Truyen, Uwe Möstl, Karin Hosie, Margaret J. Viruses Review Feline morbillivirus (FeMV) was first isolated in 2012 from stray cats in Hong Kong. It has been found in association with tubulointerstitial nephritis (TIN), the most common cause of feline chronic kidney disease (CKD). However, viral host spectrum and virus tropism go beyond the domestic cat and kidney tissues. The viral genetic diversity of FeMV is extensive, but it is not known if this is clinically relevant. Urine and kidney tissues have been widely tested in attempts to confirm associations between FeMV infection and renal disease, but samples from both healthy and sick cats can test positive and some cross-sectional studies have not found associations between FeMV infection and CKD. There is also evidence for acute kidney injury following infection with FeMV. The results of prevalence studies differ greatly depending on the population tested and methodologies used for detection, but worldwide distribution of FeMV has been shown. Experimental studies have confirmed previous field observations that higher viral loads are present in the urine compared to other tissues, and renal TIN lesions associated with FeMV antigen have been demonstrated, alongside virus lymphotropism and viraemia-associated lymphopenia. Longitudinal field studies have revealed persistent viral shedding in urine, although infection can be cleared spontaneously. MDPI 2023-10-13 /pmc/articles/PMC10611265/ /pubmed/37896864 http://dx.doi.org/10.3390/v15102087 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Pennisi, Maria Grazia
Belák, Sándor
Tasker, Séverine
Addie, Diane D.
Boucraut-Baralon, Corine
Egberink, Herman
Frymus, Tadeusz
Hartmann, Katrin
Hofmann-Lehmann, Regina
Lloret, Albert
Marsilio, Fulvio
Thiry, Etienne
Truyen, Uwe
Möstl, Karin
Hosie, Margaret J.
Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title_full Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title_fullStr Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title_full_unstemmed Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title_short Feline Morbillivirus: Clinical Relevance of a Widespread Endemic Viral Infection of Cats
title_sort feline morbillivirus: clinical relevance of a widespread endemic viral infection of cats
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10611265/
https://www.ncbi.nlm.nih.gov/pubmed/37896864
http://dx.doi.org/10.3390/v15102087
work_keys_str_mv AT pennisimariagrazia felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT belaksandor felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT taskerseverine felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT addiedianed felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT boucrautbaraloncorine felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT egberinkherman felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT frymustadeusz felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT hartmannkatrin felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT hofmannlehmannregina felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT lloretalbert felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT marsiliofulvio felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT thiryetienne felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT truyenuwe felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT mostlkarin felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats
AT hosiemargaretj felinemorbillivirusclinicalrelevanceofawidespreadendemicviralinfectionofcats