Cargando…
Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering
Phosphatidylethanolamine binding protein (PEBP) plays an important role in regulating flowering time and morphogenesis of plants. However, the identification and functional analysis of PEBP gene in pineapple (AcPEBP) have not been systematically studied. The pineapple genome contained 11 PEBP family...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10641017/ https://www.ncbi.nlm.nih.gov/pubmed/37965004 http://dx.doi.org/10.3389/fpls.2023.1277436 |
_version_ | 1785146682314326016 |
---|---|
author | Zhang, Xiaohan Ouyang, Yanwei Zhao, Lei Li, Ziqiong Zhang, Hongna Wei, Yongzan |
author_facet | Zhang, Xiaohan Ouyang, Yanwei Zhao, Lei Li, Ziqiong Zhang, Hongna Wei, Yongzan |
author_sort | Zhang, Xiaohan |
collection | PubMed |
description | Phosphatidylethanolamine binding protein (PEBP) plays an important role in regulating flowering time and morphogenesis of plants. However, the identification and functional analysis of PEBP gene in pineapple (AcPEBP) have not been systematically studied. The pineapple genome contained 11 PEBP family members, which were subsequently classified into three subfamilies (FT-like, TFL-like and MFT-like) based on phylogenetic relationships. The arrangement of these 11 shows an unequal pattern across the six chromosomes of pineapple the pineapple genome. The anticipated outcomes of the promoter cis-acting elements indicate that the PEBP gene is subject to regulation by diverse light signals and endogenous hormones such as ethylene. The findings from transcriptome examination and quantitative real-time polymerase chain reaction (qRT-PCR) indicate that FT-like members AcFT3 and AcFT4 display a heightened expression level, specifically within the floral structures. The expression of AcFT3 and AcFT4 increases sharply and remains at a high level after 4 days of ethylene induction, while the expression of AcFT7 and AcMFT1 decreases gradually during the flowering process. Additionally, AcFT3, AcFT4 and AcFT7 show specific expression in different floral organs of pineapple. These outcomes imply that members belonging to the FT-like subfamily may have a significant impact on the process of bud differentiation and flower development. Through transcriptional activation analysis, it was determined that AcFT4 possesses transcriptional activation capability and is situated in the nucleus and peripheral cytoplasm. Overexpression of AcFT4 in Arabidopsis resulted in the promotion of early flowering by 6-7 days. The protein interaction prediction network identified potential flower regulators, including CO, AP1, LFY and SOC1, that may interact with PEBP proteins. This study explores flower development in pineapple, thereby serving as a valuable reference for future research endeavors in this domain. |
format | Online Article Text |
id | pubmed-10641017 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-106410172023-11-14 Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering Zhang, Xiaohan Ouyang, Yanwei Zhao, Lei Li, Ziqiong Zhang, Hongna Wei, Yongzan Front Plant Sci Plant Science Phosphatidylethanolamine binding protein (PEBP) plays an important role in regulating flowering time and morphogenesis of plants. However, the identification and functional analysis of PEBP gene in pineapple (AcPEBP) have not been systematically studied. The pineapple genome contained 11 PEBP family members, which were subsequently classified into three subfamilies (FT-like, TFL-like and MFT-like) based on phylogenetic relationships. The arrangement of these 11 shows an unequal pattern across the six chromosomes of pineapple the pineapple genome. The anticipated outcomes of the promoter cis-acting elements indicate that the PEBP gene is subject to regulation by diverse light signals and endogenous hormones such as ethylene. The findings from transcriptome examination and quantitative real-time polymerase chain reaction (qRT-PCR) indicate that FT-like members AcFT3 and AcFT4 display a heightened expression level, specifically within the floral structures. The expression of AcFT3 and AcFT4 increases sharply and remains at a high level after 4 days of ethylene induction, while the expression of AcFT7 and AcMFT1 decreases gradually during the flowering process. Additionally, AcFT3, AcFT4 and AcFT7 show specific expression in different floral organs of pineapple. These outcomes imply that members belonging to the FT-like subfamily may have a significant impact on the process of bud differentiation and flower development. Through transcriptional activation analysis, it was determined that AcFT4 possesses transcriptional activation capability and is situated in the nucleus and peripheral cytoplasm. Overexpression of AcFT4 in Arabidopsis resulted in the promotion of early flowering by 6-7 days. The protein interaction prediction network identified potential flower regulators, including CO, AP1, LFY and SOC1, that may interact with PEBP proteins. This study explores flower development in pineapple, thereby serving as a valuable reference for future research endeavors in this domain. Frontiers Media S.A. 2023-10-26 /pmc/articles/PMC10641017/ /pubmed/37965004 http://dx.doi.org/10.3389/fpls.2023.1277436 Text en Copyright © 2023 Zhang, Ouyang, Zhao, Li, Zhang and Wei https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Plant Science Zhang, Xiaohan Ouyang, Yanwei Zhao, Lei Li, Ziqiong Zhang, Hongna Wei, Yongzan Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title | Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title_full | Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title_fullStr | Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title_full_unstemmed | Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title_short | Genome-wide identification of PEBP gene family in pineapple reveal its potential functions in flowering |
title_sort | genome-wide identification of pebp gene family in pineapple reveal its potential functions in flowering |
topic | Plant Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10641017/ https://www.ncbi.nlm.nih.gov/pubmed/37965004 http://dx.doi.org/10.3389/fpls.2023.1277436 |
work_keys_str_mv | AT zhangxiaohan genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering AT ouyangyanwei genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering AT zhaolei genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering AT liziqiong genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering AT zhanghongna genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering AT weiyongzan genomewideidentificationofpebpgenefamilyinpineapplerevealitspotentialfunctionsinflowering |