Cargando…

ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects

Primary ciliary dyskinesia (PCD) is a genetically heterogeneous disorder caused by defects in motile ciliary function and/or structure. Outer dynein arm docking complex subunit 1 (ODAD1) is an important component of the outer dynein arm docking complex (ODA-DC). To date, 13 likely pathogenic mutatio...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Nannan, Liang, Weilin, Zhang, Yanzhu, Quan, Guoli, Li, Ting, Huang, Siqing, Huo, Yating, Cui, Haiyan, Cheng, Yuanxiong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10651219/
https://www.ncbi.nlm.nih.gov/pubmed/38028630
http://dx.doi.org/10.3389/fgene.2023.1270278
_version_ 1785135947652792320
author Zhou, Nannan
Liang, Weilin
Zhang, Yanzhu
Quan, Guoli
Li, Ting
Huang, Siqing
Huo, Yating
Cui, Haiyan
Cheng, Yuanxiong
author_facet Zhou, Nannan
Liang, Weilin
Zhang, Yanzhu
Quan, Guoli
Li, Ting
Huang, Siqing
Huo, Yating
Cui, Haiyan
Cheng, Yuanxiong
author_sort Zhou, Nannan
collection PubMed
description Primary ciliary dyskinesia (PCD) is a genetically heterogeneous disorder caused by defects in motile ciliary function and/or structure. Outer dynein arm docking complex subunit 1 (ODAD1) is an important component of the outer dynein arm docking complex (ODA-DC). To date, 13 likely pathogenic mutations of ODAD1 have been reported. However, the pathogenesis of ODAD1 mutations remains elusive. To investigate the pathogenesis of splice-site mutations in ODAD1 discovered in this study and those reported previously, molecular and functional analyses were performed. Whole-exome sequencing revealed a compound mutation in ODAD1 (c.71-2A>C; c.598-2A>C) in a patient with PCD, with c.598-2A>C being a novel mutation that resulted in two mutant transcripts. The compound mutation in ODAD1 (c.71-2A>C; c.598-2A>C) led to aberrant splicing that resulted in the absence of the wild-type ODAD1 and defects of the outer dynein arm in ciliary axonemes, causing a decrease in ciliary beat frequency. Furthermore, we demonstrated that the truncated proteins resulting from splice-site mutations in ODAD1 could retain partial function and inhibit the interaction between wild-type ODAD1 and ODAD3. The results of this study expand the mutational and clinical spectrum of PCD, provide more evidence for genetic counseling, and offer new insights into gene-based therapeutic strategies for PCD.
format Online
Article
Text
id pubmed-10651219
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-106512192023-10-31 ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects Zhou, Nannan Liang, Weilin Zhang, Yanzhu Quan, Guoli Li, Ting Huang, Siqing Huo, Yating Cui, Haiyan Cheng, Yuanxiong Front Genet Genetics Primary ciliary dyskinesia (PCD) is a genetically heterogeneous disorder caused by defects in motile ciliary function and/or structure. Outer dynein arm docking complex subunit 1 (ODAD1) is an important component of the outer dynein arm docking complex (ODA-DC). To date, 13 likely pathogenic mutations of ODAD1 have been reported. However, the pathogenesis of ODAD1 mutations remains elusive. To investigate the pathogenesis of splice-site mutations in ODAD1 discovered in this study and those reported previously, molecular and functional analyses were performed. Whole-exome sequencing revealed a compound mutation in ODAD1 (c.71-2A>C; c.598-2A>C) in a patient with PCD, with c.598-2A>C being a novel mutation that resulted in two mutant transcripts. The compound mutation in ODAD1 (c.71-2A>C; c.598-2A>C) led to aberrant splicing that resulted in the absence of the wild-type ODAD1 and defects of the outer dynein arm in ciliary axonemes, causing a decrease in ciliary beat frequency. Furthermore, we demonstrated that the truncated proteins resulting from splice-site mutations in ODAD1 could retain partial function and inhibit the interaction between wild-type ODAD1 and ODAD3. The results of this study expand the mutational and clinical spectrum of PCD, provide more evidence for genetic counseling, and offer new insights into gene-based therapeutic strategies for PCD. Frontiers Media S.A. 2023-10-31 /pmc/articles/PMC10651219/ /pubmed/38028630 http://dx.doi.org/10.3389/fgene.2023.1270278 Text en Copyright © 2023 Zhou, Liang, Zhang, Quan, Li, Huang, Huo, Cui and Cheng. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Genetics
Zhou, Nannan
Liang, Weilin
Zhang, Yanzhu
Quan, Guoli
Li, Ting
Huang, Siqing
Huo, Yating
Cui, Haiyan
Cheng, Yuanxiong
ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title_full ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title_fullStr ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title_full_unstemmed ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title_short ODAD1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
title_sort odad1 variants resulting from splice-site mutations retain partial function and cause primary ciliary dyskinesia with outer dynein arm defects
topic Genetics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10651219/
https://www.ncbi.nlm.nih.gov/pubmed/38028630
http://dx.doi.org/10.3389/fgene.2023.1270278
work_keys_str_mv AT zhounannan odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT liangweilin odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT zhangyanzhu odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT quanguoli odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT liting odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT huangsiqing odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT huoyating odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT cuihaiyan odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects
AT chengyuanxiong odad1variantsresultingfromsplicesitemutationsretainpartialfunctionandcauseprimaryciliarydyskinesiawithouterdyneinarmdefects