Cargando…

Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study

BACKGROUND: Private pharmacies are the first point of contact for the public regarding acquisition of medicines and other pharmaceuticals in many low- and middle-income countries including Uganda. Most antimicrobial stewardship (AMS) programmes in Uganda have targeted pharmacies in public health fac...

Descripción completa

Detalles Bibliográficos
Autores principales: Musoke, David, Lubega, Grace Biyinzika, Gbadesire, Mimi Salome, Boateng, Stephanie, Twesigye, Belinda, Gheer, Jagdeep, Nakachwa, Betty, Brown, Michael Obeng, Brandish, Claire, Winter, Jody, Ng, Bee Yean, Russell-Hobbs, Kate, Gibson, Linda
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10655315/
https://www.ncbi.nlm.nih.gov/pubmed/37978569
http://dx.doi.org/10.1186/s40545-023-00659-5
_version_ 1785147919420096512
author Musoke, David
Lubega, Grace Biyinzika
Gbadesire, Mimi Salome
Boateng, Stephanie
Twesigye, Belinda
Gheer, Jagdeep
Nakachwa, Betty
Brown, Michael Obeng
Brandish, Claire
Winter, Jody
Ng, Bee Yean
Russell-Hobbs, Kate
Gibson, Linda
author_facet Musoke, David
Lubega, Grace Biyinzika
Gbadesire, Mimi Salome
Boateng, Stephanie
Twesigye, Belinda
Gheer, Jagdeep
Nakachwa, Betty
Brown, Michael Obeng
Brandish, Claire
Winter, Jody
Ng, Bee Yean
Russell-Hobbs, Kate
Gibson, Linda
author_sort Musoke, David
collection PubMed
description BACKGROUND: Private pharmacies are the first point of contact for the public regarding acquisition of medicines and other pharmaceuticals in many low- and middle-income countries including Uganda. Most antimicrobial stewardship (AMS) programmes in Uganda have targeted pharmacies in public health facilities, with little known about private pharmacies. This study explored knowledge and practices related to AMS in private pharmacies in Wakiso district, central Uganda. METHODS: This was a qualitative study that involved 31 in-depth interviews to explore AMS among retail private pharmacy staff including pharmacists, pharmacy technicians/dispensers, and nurses. Participants were asked about antimicrobial resistance (AMR) and AMS practices at their pharmacy. The audio-recorded interviews were transcribed verbatim and imported to NVivo 2020 (QSR International) for thematic analysis. RESULTS: Five major themes emerged from the study: commonly sold antimicrobials; knowledge on AMR and AMS; potential contributors to AMR; practices related to AMS; and challenges to AMS. The commonly sold antimicrobials in the pharmacies with or without prescriptions were oral azithromycin, Ampiclox(®) (ampicillin and cloxacillin), amoxicillin, ciprofloxacin, Septrin(®) (co-trimoxazole), metronidazole, Flucamox(®) (amoxicillin and flucloxacillin), Augmentin(®) (amoxicillin and clavulanic acid), cephalexin, doxycycline, and chloramphenicol. Participants had heard about AMR but not AMS, although only a few correctly defined AMR. Lack of knowledge among health workers and local communities; the overuse, misuse, and abuse of antimicrobials such as non-adherence to dosage; self-medication; and purchase of drugs without prescription were identified as potential accelerators to the emergence of AMR. Current practices related to AMS in private pharmacies were limited to meetings, antimicrobial dispensing, providing client advice, record keeping, and monitoring of drugs. Cost of healthcare, client satisfaction and retention, outdated guidelines, and the business orientation of pharmacies were the main challenges related to AMS. CONCLUSION: There was poor knowledge of AMR and AMS, and limited AMS practices in private pharmacies. Private pharmacies have the potential to contribute to Uganda’s fight against AMR if motivated and equipped with adequate knowledge to enhance their practices related to AMS.
format Online
Article
Text
id pubmed-10655315
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-106553152023-11-17 Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study Musoke, David Lubega, Grace Biyinzika Gbadesire, Mimi Salome Boateng, Stephanie Twesigye, Belinda Gheer, Jagdeep Nakachwa, Betty Brown, Michael Obeng Brandish, Claire Winter, Jody Ng, Bee Yean Russell-Hobbs, Kate Gibson, Linda J Pharm Policy Pract Research BACKGROUND: Private pharmacies are the first point of contact for the public regarding acquisition of medicines and other pharmaceuticals in many low- and middle-income countries including Uganda. Most antimicrobial stewardship (AMS) programmes in Uganda have targeted pharmacies in public health facilities, with little known about private pharmacies. This study explored knowledge and practices related to AMS in private pharmacies in Wakiso district, central Uganda. METHODS: This was a qualitative study that involved 31 in-depth interviews to explore AMS among retail private pharmacy staff including pharmacists, pharmacy technicians/dispensers, and nurses. Participants were asked about antimicrobial resistance (AMR) and AMS practices at their pharmacy. The audio-recorded interviews were transcribed verbatim and imported to NVivo 2020 (QSR International) for thematic analysis. RESULTS: Five major themes emerged from the study: commonly sold antimicrobials; knowledge on AMR and AMS; potential contributors to AMR; practices related to AMS; and challenges to AMS. The commonly sold antimicrobials in the pharmacies with or without prescriptions were oral azithromycin, Ampiclox(®) (ampicillin and cloxacillin), amoxicillin, ciprofloxacin, Septrin(®) (co-trimoxazole), metronidazole, Flucamox(®) (amoxicillin and flucloxacillin), Augmentin(®) (amoxicillin and clavulanic acid), cephalexin, doxycycline, and chloramphenicol. Participants had heard about AMR but not AMS, although only a few correctly defined AMR. Lack of knowledge among health workers and local communities; the overuse, misuse, and abuse of antimicrobials such as non-adherence to dosage; self-medication; and purchase of drugs without prescription were identified as potential accelerators to the emergence of AMR. Current practices related to AMS in private pharmacies were limited to meetings, antimicrobial dispensing, providing client advice, record keeping, and monitoring of drugs. Cost of healthcare, client satisfaction and retention, outdated guidelines, and the business orientation of pharmacies were the main challenges related to AMS. CONCLUSION: There was poor knowledge of AMR and AMS, and limited AMS practices in private pharmacies. Private pharmacies have the potential to contribute to Uganda’s fight against AMR if motivated and equipped with adequate knowledge to enhance their practices related to AMS. BioMed Central 2023-11-17 /pmc/articles/PMC10655315/ /pubmed/37978569 http://dx.doi.org/10.1186/s40545-023-00659-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Musoke, David
Lubega, Grace Biyinzika
Gbadesire, Mimi Salome
Boateng, Stephanie
Twesigye, Belinda
Gheer, Jagdeep
Nakachwa, Betty
Brown, Michael Obeng
Brandish, Claire
Winter, Jody
Ng, Bee Yean
Russell-Hobbs, Kate
Gibson, Linda
Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title_full Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title_fullStr Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title_full_unstemmed Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title_short Antimicrobial stewardship in private pharmacies in Wakiso district, Uganda: a qualitative study
title_sort antimicrobial stewardship in private pharmacies in wakiso district, uganda: a qualitative study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10655315/
https://www.ncbi.nlm.nih.gov/pubmed/37978569
http://dx.doi.org/10.1186/s40545-023-00659-5
work_keys_str_mv AT musokedavid antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT lubegagracebiyinzika antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT gbadesiremimisalome antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT boatengstephanie antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT twesigyebelinda antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT gheerjagdeep antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT nakachwabetty antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT brownmichaelobeng antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT brandishclaire antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT winterjody antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT ngbeeyean antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT russellhobbskate antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy
AT gibsonlinda antimicrobialstewardshipinprivatepharmaciesinwakisodistrictugandaaqualitativestudy