Cargando…

CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial

The oncofetal antigen Claudin 6 (CLDN6) is highly and specifically expressed in many solid tumors, and could be a promising treatment target. We report dose escalation results from the ongoing phase 1/2 BNT211-01 trial evaluating the safety and feasibility of chimeric antigen receptor (CAR) T cells...

Descripción completa

Detalles Bibliográficos
Autores principales: Mackensen, Andreas, Haanen, John B.A.G., Koenecke, Christian, Alsdorf, Winfried, Wagner-Drouet, Eva, Borchmann, Peter, Heudobler, Daniel, Ferstl, Barbara, Klobuch, Sebastian, Bokemeyer, Carsten, Desuki, Alexander, Lüke, Florian, Kutsch, Nadine, Müller, Fabian, Smit, Eveline, Hillemanns, Peter, Karagiannis, Panagiotis, Wiegert, Erol, He, Ying, Ho, Thang, Kang-Fortner, Qing, Schlitter, Anna Melissa, Schulz-Eying, Catrine, Finlayson, Andrew, Flemmig, Carina, Kühlcke, Klaus, Preußner, Liane, Rengstl, Benjamin, Türeci, Özlem, Şahin, Uğur
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group US 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10667102/
https://www.ncbi.nlm.nih.gov/pubmed/37872225
http://dx.doi.org/10.1038/s41591-023-02612-0
_version_ 1785139177544744960
author Mackensen, Andreas
Haanen, John B.A.G.
Koenecke, Christian
Alsdorf, Winfried
Wagner-Drouet, Eva
Borchmann, Peter
Heudobler, Daniel
Ferstl, Barbara
Klobuch, Sebastian
Bokemeyer, Carsten
Desuki, Alexander
Lüke, Florian
Kutsch, Nadine
Müller, Fabian
Smit, Eveline
Hillemanns, Peter
Karagiannis, Panagiotis
Wiegert, Erol
He, Ying
Ho, Thang
Kang-Fortner, Qing
Schlitter, Anna Melissa
Schulz-Eying, Catrine
Finlayson, Andrew
Flemmig, Carina
Kühlcke, Klaus
Preußner, Liane
Rengstl, Benjamin
Türeci, Özlem
Şahin, Uğur
author_facet Mackensen, Andreas
Haanen, John B.A.G.
Koenecke, Christian
Alsdorf, Winfried
Wagner-Drouet, Eva
Borchmann, Peter
Heudobler, Daniel
Ferstl, Barbara
Klobuch, Sebastian
Bokemeyer, Carsten
Desuki, Alexander
Lüke, Florian
Kutsch, Nadine
Müller, Fabian
Smit, Eveline
Hillemanns, Peter
Karagiannis, Panagiotis
Wiegert, Erol
He, Ying
Ho, Thang
Kang-Fortner, Qing
Schlitter, Anna Melissa
Schulz-Eying, Catrine
Finlayson, Andrew
Flemmig, Carina
Kühlcke, Klaus
Preußner, Liane
Rengstl, Benjamin
Türeci, Özlem
Şahin, Uğur
author_sort Mackensen, Andreas
collection PubMed
description The oncofetal antigen Claudin 6 (CLDN6) is highly and specifically expressed in many solid tumors, and could be a promising treatment target. We report dose escalation results from the ongoing phase 1/2 BNT211-01 trial evaluating the safety and feasibility of chimeric antigen receptor (CAR) T cells targeting the CLDN6 with or without a CAR-T cell-amplifying RNA vaccine (CARVac) at two dose levels (DLs) in relapsed/refractory CLDN6-positive solid tumors. The primary endpoints were safety and tolerability, maximum tolerated dose and recommended phase 2 dose (RP2D). Secondary endpoints included objective response rate (ORR) and disease control rate. We observed manageable toxicity, with 10 out of 22 patients (46%) experiencing cytokine release syndrome including one grade 3 event and 1 out of 22 (5%) with grade 1 immune effector cell-associated neurotoxicity syndrome. Dose-limiting toxicities occurred in two patients at the higher DL, resolving without sequelae. CAR-T cell engraftment was robust, and the addition of CARVac was well tolerated. The unconfirmed ORR in 21 evaluable patients was 33% (7 of 21), including one complete response. The disease control rate was 67% (14 of 21), with stable disease in seven patients. Patients with germ cell tumors treated at the higher DL exhibited the highest response rate (ORR 57% (4 of 7)). The maximum tolerated dose and RP2D were not established as the trial has been amended to utilize an automated manufacturing process. A repeat of the dose escalation is ongoing and will identify a RP2D for pivotal trials. ClinicalTrials.gov Identifier: NCT04503278.
format Online
Article
Text
id pubmed-10667102
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Nature Publishing Group US
record_format MEDLINE/PubMed
spelling pubmed-106671022023-10-23 CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial Mackensen, Andreas Haanen, John B.A.G. Koenecke, Christian Alsdorf, Winfried Wagner-Drouet, Eva Borchmann, Peter Heudobler, Daniel Ferstl, Barbara Klobuch, Sebastian Bokemeyer, Carsten Desuki, Alexander Lüke, Florian Kutsch, Nadine Müller, Fabian Smit, Eveline Hillemanns, Peter Karagiannis, Panagiotis Wiegert, Erol He, Ying Ho, Thang Kang-Fortner, Qing Schlitter, Anna Melissa Schulz-Eying, Catrine Finlayson, Andrew Flemmig, Carina Kühlcke, Klaus Preußner, Liane Rengstl, Benjamin Türeci, Özlem Şahin, Uğur Nat Med Article The oncofetal antigen Claudin 6 (CLDN6) is highly and specifically expressed in many solid tumors, and could be a promising treatment target. We report dose escalation results from the ongoing phase 1/2 BNT211-01 trial evaluating the safety and feasibility of chimeric antigen receptor (CAR) T cells targeting the CLDN6 with or without a CAR-T cell-amplifying RNA vaccine (CARVac) at two dose levels (DLs) in relapsed/refractory CLDN6-positive solid tumors. The primary endpoints were safety and tolerability, maximum tolerated dose and recommended phase 2 dose (RP2D). Secondary endpoints included objective response rate (ORR) and disease control rate. We observed manageable toxicity, with 10 out of 22 patients (46%) experiencing cytokine release syndrome including one grade 3 event and 1 out of 22 (5%) with grade 1 immune effector cell-associated neurotoxicity syndrome. Dose-limiting toxicities occurred in two patients at the higher DL, resolving without sequelae. CAR-T cell engraftment was robust, and the addition of CARVac was well tolerated. The unconfirmed ORR in 21 evaluable patients was 33% (7 of 21), including one complete response. The disease control rate was 67% (14 of 21), with stable disease in seven patients. Patients with germ cell tumors treated at the higher DL exhibited the highest response rate (ORR 57% (4 of 7)). The maximum tolerated dose and RP2D were not established as the trial has been amended to utilize an automated manufacturing process. A repeat of the dose escalation is ongoing and will identify a RP2D for pivotal trials. ClinicalTrials.gov Identifier: NCT04503278. Nature Publishing Group US 2023-10-23 2023 /pmc/articles/PMC10667102/ /pubmed/37872225 http://dx.doi.org/10.1038/s41591-023-02612-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Mackensen, Andreas
Haanen, John B.A.G.
Koenecke, Christian
Alsdorf, Winfried
Wagner-Drouet, Eva
Borchmann, Peter
Heudobler, Daniel
Ferstl, Barbara
Klobuch, Sebastian
Bokemeyer, Carsten
Desuki, Alexander
Lüke, Florian
Kutsch, Nadine
Müller, Fabian
Smit, Eveline
Hillemanns, Peter
Karagiannis, Panagiotis
Wiegert, Erol
He, Ying
Ho, Thang
Kang-Fortner, Qing
Schlitter, Anna Melissa
Schulz-Eying, Catrine
Finlayson, Andrew
Flemmig, Carina
Kühlcke, Klaus
Preußner, Liane
Rengstl, Benjamin
Türeci, Özlem
Şahin, Uğur
CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title_full CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title_fullStr CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title_full_unstemmed CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title_short CLDN6-specific CAR-T cells plus amplifying RNA vaccine in relapsed or refractory solid tumors: the phase 1 BNT211-01 trial
title_sort cldn6-specific car-t cells plus amplifying rna vaccine in relapsed or refractory solid tumors: the phase 1 bnt211-01 trial
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10667102/
https://www.ncbi.nlm.nih.gov/pubmed/37872225
http://dx.doi.org/10.1038/s41591-023-02612-0
work_keys_str_mv AT mackensenandreas cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT haanenjohnbag cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT koeneckechristian cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT alsdorfwinfried cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT wagnerdroueteva cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT borchmannpeter cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT heudoblerdaniel cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT ferstlbarbara cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT klobuchsebastian cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT bokemeyercarsten cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT desukialexander cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT lukeflorian cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT kutschnadine cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT mullerfabian cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT smiteveline cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT hillemannspeter cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT karagiannispanagiotis cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT wiegerterol cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT heying cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT hothang cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT kangfortnerqing cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT schlitterannamelissa cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT schulzeyingcatrine cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT finlaysonandrew cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT flemmigcarina cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT kuhlckeklaus cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT preußnerliane cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT rengstlbenjamin cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT tureciozlem cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial
AT sahinugur cldn6specificcartcellsplusamplifyingrnavaccineinrelapsedorrefractorysolidtumorsthephase1bnt21101trial