Cargando…

Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina

(1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain whic...

Descripción completa

Detalles Bibliográficos
Autores principales: Monsalve, Rafael I., Lombardero, Manuel, Christensen, Lars H., Núñez-Acevedo, Beatriz, González-de-Olano, David, Sobrino-García, Miriam, Castillo-Loja, Rosita M., Bravo, Susana B., Alonso-Sampedro, Manuela, Vidal, Carmen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10675595/
https://www.ncbi.nlm.nih.gov/pubmed/37999519
http://dx.doi.org/10.3390/toxins15110656
_version_ 1785149833478144000
author Monsalve, Rafael I.
Lombardero, Manuel
Christensen, Lars H.
Núñez-Acevedo, Beatriz
González-de-Olano, David
Sobrino-García, Miriam
Castillo-Loja, Rosita M.
Bravo, Susana B.
Alonso-Sampedro, Manuela
Vidal, Carmen
author_facet Monsalve, Rafael I.
Lombardero, Manuel
Christensen, Lars H.
Núñez-Acevedo, Beatriz
González-de-Olano, David
Sobrino-García, Miriam
Castillo-Loja, Rosita M.
Bravo, Susana B.
Alonso-Sampedro, Manuela
Vidal, Carmen
author_sort Monsalve, Rafael I.
collection PubMed
description (1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain which regions have higher similarity among these proteins and present a comparison among them, including a new Vespa velutina DPPIV sequence. Moreover, two cases of sensitization to DPPIVs in wasp- and honeybee-sensitized patients are presented. (2) Methods: Proteomic analyses have been performed on the venom of the Asian hornet Vespa velutina to demonstrate the sequence of its DPPIV (allergen named Vesp v 3, with sequence accession number P0DRB8, and with the proteomic data available via ProteomeXchange with the identifier PXD046030). A comparison performed through their alignments and analysis of the three-dimensional structure showed a region with higher similarity among Hymenoptera DPPIVs. Additionally, ImmunoCAP™ determinations (including specific inhibition experiments), as well as IgE immunoblotting, are performed to demonstrate the allergenicity of Api m 5 and Ves v 3. (3) Results and Conclusions: The data presented demonstrate that the similarities among Hymenoptera DPPIVs are most likely localized at the C-terminal region of these enzymes. In addition, a higher similarity of the Vespa/Vespula DPPIVs is shown. The clinical cases analyzed demonstrated the allergenicity of Api m 5 and Ves v 3 in the sera of the allergic patients, as well as the presence of this minor component in the preparations used in venom immunotherapy.
format Online
Article
Text
id pubmed-10675595
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-106755952023-11-14 Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina Monsalve, Rafael I. Lombardero, Manuel Christensen, Lars H. Núñez-Acevedo, Beatriz González-de-Olano, David Sobrino-García, Miriam Castillo-Loja, Rosita M. Bravo, Susana B. Alonso-Sampedro, Manuela Vidal, Carmen Toxins (Basel) Article (1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain which regions have higher similarity among these proteins and present a comparison among them, including a new Vespa velutina DPPIV sequence. Moreover, two cases of sensitization to DPPIVs in wasp- and honeybee-sensitized patients are presented. (2) Methods: Proteomic analyses have been performed on the venom of the Asian hornet Vespa velutina to demonstrate the sequence of its DPPIV (allergen named Vesp v 3, with sequence accession number P0DRB8, and with the proteomic data available via ProteomeXchange with the identifier PXD046030). A comparison performed through their alignments and analysis of the three-dimensional structure showed a region with higher similarity among Hymenoptera DPPIVs. Additionally, ImmunoCAP™ determinations (including specific inhibition experiments), as well as IgE immunoblotting, are performed to demonstrate the allergenicity of Api m 5 and Ves v 3. (3) Results and Conclusions: The data presented demonstrate that the similarities among Hymenoptera DPPIVs are most likely localized at the C-terminal region of these enzymes. In addition, a higher similarity of the Vespa/Vespula DPPIVs is shown. The clinical cases analyzed demonstrated the allergenicity of Api m 5 and Ves v 3 in the sera of the allergic patients, as well as the presence of this minor component in the preparations used in venom immunotherapy. MDPI 2023-11-14 /pmc/articles/PMC10675595/ /pubmed/37999519 http://dx.doi.org/10.3390/toxins15110656 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Monsalve, Rafael I.
Lombardero, Manuel
Christensen, Lars H.
Núñez-Acevedo, Beatriz
González-de-Olano, David
Sobrino-García, Miriam
Castillo-Loja, Rosita M.
Bravo, Susana B.
Alonso-Sampedro, Manuela
Vidal, Carmen
Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title_full Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title_fullStr Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title_full_unstemmed Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title_short Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
title_sort structural similarities, in relation with the cross-reactivity, of hymenoptera allergenic dipeptidyl peptidases iv—an overall comparison including a new dipeptidyl peptidase iv sequence from vespa velutina
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10675595/
https://www.ncbi.nlm.nih.gov/pubmed/37999519
http://dx.doi.org/10.3390/toxins15110656
work_keys_str_mv AT monsalverafaeli structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT lombarderomanuel structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT christensenlarsh structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT nunezacevedobeatriz structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT gonzalezdeolanodavid structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT sobrinogarciamiriam structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT castillolojarositam structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT bravosusanab structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT alonsosampedromanuela structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina
AT vidalcarmen structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina