Cargando…
Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina
(1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain whic...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10675595/ https://www.ncbi.nlm.nih.gov/pubmed/37999519 http://dx.doi.org/10.3390/toxins15110656 |
_version_ | 1785149833478144000 |
---|---|
author | Monsalve, Rafael I. Lombardero, Manuel Christensen, Lars H. Núñez-Acevedo, Beatriz González-de-Olano, David Sobrino-García, Miriam Castillo-Loja, Rosita M. Bravo, Susana B. Alonso-Sampedro, Manuela Vidal, Carmen |
author_facet | Monsalve, Rafael I. Lombardero, Manuel Christensen, Lars H. Núñez-Acevedo, Beatriz González-de-Olano, David Sobrino-García, Miriam Castillo-Loja, Rosita M. Bravo, Susana B. Alonso-Sampedro, Manuela Vidal, Carmen |
author_sort | Monsalve, Rafael I. |
collection | PubMed |
description | (1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain which regions have higher similarity among these proteins and present a comparison among them, including a new Vespa velutina DPPIV sequence. Moreover, two cases of sensitization to DPPIVs in wasp- and honeybee-sensitized patients are presented. (2) Methods: Proteomic analyses have been performed on the venom of the Asian hornet Vespa velutina to demonstrate the sequence of its DPPIV (allergen named Vesp v 3, with sequence accession number P0DRB8, and with the proteomic data available via ProteomeXchange with the identifier PXD046030). A comparison performed through their alignments and analysis of the three-dimensional structure showed a region with higher similarity among Hymenoptera DPPIVs. Additionally, ImmunoCAP™ determinations (including specific inhibition experiments), as well as IgE immunoblotting, are performed to demonstrate the allergenicity of Api m 5 and Ves v 3. (3) Results and Conclusions: The data presented demonstrate that the similarities among Hymenoptera DPPIVs are most likely localized at the C-terminal region of these enzymes. In addition, a higher similarity of the Vespa/Vespula DPPIVs is shown. The clinical cases analyzed demonstrated the allergenicity of Api m 5 and Ves v 3 in the sera of the allergic patients, as well as the presence of this minor component in the preparations used in venom immunotherapy. |
format | Online Article Text |
id | pubmed-10675595 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-106755952023-11-14 Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina Monsalve, Rafael I. Lombardero, Manuel Christensen, Lars H. Núñez-Acevedo, Beatriz González-de-Olano, David Sobrino-García, Miriam Castillo-Loja, Rosita M. Bravo, Susana B. Alonso-Sampedro, Manuela Vidal, Carmen Toxins (Basel) Article (1) Background: Dipeptidyl Peptidases IV (DPPIVs), present in many organisms, are minor components in the venoms of Hymenoptera, where they have been identified as cross-reactive allergenic molecules. Considering that the structure of homologous DPPIVs is well characterized, we aimed to explain which regions have higher similarity among these proteins and present a comparison among them, including a new Vespa velutina DPPIV sequence. Moreover, two cases of sensitization to DPPIVs in wasp- and honeybee-sensitized patients are presented. (2) Methods: Proteomic analyses have been performed on the venom of the Asian hornet Vespa velutina to demonstrate the sequence of its DPPIV (allergen named Vesp v 3, with sequence accession number P0DRB8, and with the proteomic data available via ProteomeXchange with the identifier PXD046030). A comparison performed through their alignments and analysis of the three-dimensional structure showed a region with higher similarity among Hymenoptera DPPIVs. Additionally, ImmunoCAP™ determinations (including specific inhibition experiments), as well as IgE immunoblotting, are performed to demonstrate the allergenicity of Api m 5 and Ves v 3. (3) Results and Conclusions: The data presented demonstrate that the similarities among Hymenoptera DPPIVs are most likely localized at the C-terminal region of these enzymes. In addition, a higher similarity of the Vespa/Vespula DPPIVs is shown. The clinical cases analyzed demonstrated the allergenicity of Api m 5 and Ves v 3 in the sera of the allergic patients, as well as the presence of this minor component in the preparations used in venom immunotherapy. MDPI 2023-11-14 /pmc/articles/PMC10675595/ /pubmed/37999519 http://dx.doi.org/10.3390/toxins15110656 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Monsalve, Rafael I. Lombardero, Manuel Christensen, Lars H. Núñez-Acevedo, Beatriz González-de-Olano, David Sobrino-García, Miriam Castillo-Loja, Rosita M. Bravo, Susana B. Alonso-Sampedro, Manuela Vidal, Carmen Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title | Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title_full | Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title_fullStr | Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title_full_unstemmed | Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title_short | Structural Similarities, in Relation with the Cross-Reactivity, of Hymenoptera Allergenic Dipeptidyl Peptidases IV—An Overall Comparison Including a New Dipeptidyl Peptidase IV Sequence from Vespa velutina |
title_sort | structural similarities, in relation with the cross-reactivity, of hymenoptera allergenic dipeptidyl peptidases iv—an overall comparison including a new dipeptidyl peptidase iv sequence from vespa velutina |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10675595/ https://www.ncbi.nlm.nih.gov/pubmed/37999519 http://dx.doi.org/10.3390/toxins15110656 |
work_keys_str_mv | AT monsalverafaeli structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT lombarderomanuel structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT christensenlarsh structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT nunezacevedobeatriz structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT gonzalezdeolanodavid structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT sobrinogarciamiriam structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT castillolojarositam structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT bravosusanab structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT alonsosampedromanuela structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina AT vidalcarmen structuralsimilaritiesinrelationwiththecrossreactivityofhymenopteraallergenicdipeptidylpeptidasesivanoverallcomparisonincludinganewdipeptidylpeptidaseivsequencefromvespavelutina |