Cargando…

Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review

PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyl...

Descripción completa

Detalles Bibliográficos
Autores principales: Tingen, H. S. A., Tubben, A., van ’t Oever, J. H., Pastoor, E. M., van Zon, P. P. A., Nienhuis, H. L. A., van der Meer, P., Slart, R. H J. A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Berlin Heidelberg 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10684414/
https://www.ncbi.nlm.nih.gov/pubmed/37561144
http://dx.doi.org/10.1007/s00259-023-06381-3
_version_ 1785151397931515904
author Tingen, H. S. A.
Tubben, A.
van ’t Oever, J. H.
Pastoor, E. M.
van Zon, P. P. A.
Nienhuis, H. L. A.
van der Meer, P.
Slart, R. H J. A.
author_facet Tingen, H. S. A.
Tubben, A.
van ’t Oever, J. H.
Pastoor, E. M.
van Zon, P. P. A.
Nienhuis, H. L. A.
van der Meer, P.
Slart, R. H J. A.
author_sort Tingen, H. S. A.
collection PubMed
description PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyloid cardiomyopathy (ATTR-CM) patients. METHODS: Medline, Cochrane Library, Embase and Web of Science databases were searched, from the earliest date available until December 2022, for studies investigating the use of PET in ATTR-CM patients. Studies containing original data were included, except for case reports. Risk of bias was assessed by QUADAS-2. RESULTS: Twenty-one studies were included in this systematic review, investigating five different tracers: carbon-11 Pittsburgh compound B ([(11)C]PIB), fluorine-18 Florbetaben ([(18)F]FBB), fluorine-18 Florbetapir ([(18)F]FBP), fluorine-18 Flutemetamol ([(18)F]FMM) and fluorine-18 Sodium Fluoride (Na[(18)F]F). In total 211 ATTR amyloidosis patients were included. A majority of studies concluded that [(11)C]PIB, [(18)F]FBP and Na[(18)F]F can distinguish ATTR amyloidosis patients from controls, and that [(11)C]PIB and Na[(18)F]F, but not [(18)F]FBP, can distinguish ATTR-CM patients from patients with cardiac light chain amyloidosis. Evidence on the performance of [(18)F]FBB and [(18)F]FMM was contradictory. No studies on the use of PET in follow-up were found. CONCLUSION: [(11)C]PIB, Na[(18)F]F and [(18)F]FBP can be used to diagnose cardiac amyloidosis, although [(18)F]FBP may not be suitable for the distinction of different types of amyloid cardiomyopathy. No studies on PET in the follow-up of ATTR amyloidosis patients were found. Future research should focus on the use of these PET tracers in the follow-up of ATTR amyloidosis patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00259-023-06381-3.
format Online
Article
Text
id pubmed-10684414
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Springer Berlin Heidelberg
record_format MEDLINE/PubMed
spelling pubmed-106844142023-11-30 Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review Tingen, H. S. A. Tubben, A. van ’t Oever, J. H. Pastoor, E. M. van Zon, P. P. A. Nienhuis, H. L. A. van der Meer, P. Slart, R. H J. A. Eur J Nucl Med Mol Imaging Review Article PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyloid cardiomyopathy (ATTR-CM) patients. METHODS: Medline, Cochrane Library, Embase and Web of Science databases were searched, from the earliest date available until December 2022, for studies investigating the use of PET in ATTR-CM patients. Studies containing original data were included, except for case reports. Risk of bias was assessed by QUADAS-2. RESULTS: Twenty-one studies were included in this systematic review, investigating five different tracers: carbon-11 Pittsburgh compound B ([(11)C]PIB), fluorine-18 Florbetaben ([(18)F]FBB), fluorine-18 Florbetapir ([(18)F]FBP), fluorine-18 Flutemetamol ([(18)F]FMM) and fluorine-18 Sodium Fluoride (Na[(18)F]F). In total 211 ATTR amyloidosis patients were included. A majority of studies concluded that [(11)C]PIB, [(18)F]FBP and Na[(18)F]F can distinguish ATTR amyloidosis patients from controls, and that [(11)C]PIB and Na[(18)F]F, but not [(18)F]FBP, can distinguish ATTR-CM patients from patients with cardiac light chain amyloidosis. Evidence on the performance of [(18)F]FBB and [(18)F]FMM was contradictory. No studies on the use of PET in follow-up were found. CONCLUSION: [(11)C]PIB, Na[(18)F]F and [(18)F]FBP can be used to diagnose cardiac amyloidosis, although [(18)F]FBP may not be suitable for the distinction of different types of amyloid cardiomyopathy. No studies on PET in the follow-up of ATTR amyloidosis patients were found. Future research should focus on the use of these PET tracers in the follow-up of ATTR amyloidosis patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00259-023-06381-3. Springer Berlin Heidelberg 2023-08-10 2023 /pmc/articles/PMC10684414/ /pubmed/37561144 http://dx.doi.org/10.1007/s00259-023-06381-3 Text en © The Author(s) 2023, corrected publication 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Review Article
Tingen, H. S. A.
Tubben, A.
van ’t Oever, J. H.
Pastoor, E. M.
van Zon, P. P. A.
Nienhuis, H. L. A.
van der Meer, P.
Slart, R. H J. A.
Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title_full Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title_fullStr Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title_full_unstemmed Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title_short Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
title_sort positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: a systematic review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10684414/
https://www.ncbi.nlm.nih.gov/pubmed/37561144
http://dx.doi.org/10.1007/s00259-023-06381-3
work_keys_str_mv AT tingenhsa positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT tubbena positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT vantoeverjh positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT pastoorem positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT vanzonppa positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT nienhuishla positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT vandermeerp positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview
AT slartrhja positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview