Cargando…
Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review
PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyl...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10684414/ https://www.ncbi.nlm.nih.gov/pubmed/37561144 http://dx.doi.org/10.1007/s00259-023-06381-3 |
_version_ | 1785151397931515904 |
---|---|
author | Tingen, H. S. A. Tubben, A. van ’t Oever, J. H. Pastoor, E. M. van Zon, P. P. A. Nienhuis, H. L. A. van der Meer, P. Slart, R. H J. A. |
author_facet | Tingen, H. S. A. Tubben, A. van ’t Oever, J. H. Pastoor, E. M. van Zon, P. P. A. Nienhuis, H. L. A. van der Meer, P. Slart, R. H J. A. |
author_sort | Tingen, H. S. A. |
collection | PubMed |
description | PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyloid cardiomyopathy (ATTR-CM) patients. METHODS: Medline, Cochrane Library, Embase and Web of Science databases were searched, from the earliest date available until December 2022, for studies investigating the use of PET in ATTR-CM patients. Studies containing original data were included, except for case reports. Risk of bias was assessed by QUADAS-2. RESULTS: Twenty-one studies were included in this systematic review, investigating five different tracers: carbon-11 Pittsburgh compound B ([(11)C]PIB), fluorine-18 Florbetaben ([(18)F]FBB), fluorine-18 Florbetapir ([(18)F]FBP), fluorine-18 Flutemetamol ([(18)F]FMM) and fluorine-18 Sodium Fluoride (Na[(18)F]F). In total 211 ATTR amyloidosis patients were included. A majority of studies concluded that [(11)C]PIB, [(18)F]FBP and Na[(18)F]F can distinguish ATTR amyloidosis patients from controls, and that [(11)C]PIB and Na[(18)F]F, but not [(18)F]FBP, can distinguish ATTR-CM patients from patients with cardiac light chain amyloidosis. Evidence on the performance of [(18)F]FBB and [(18)F]FMM was contradictory. No studies on the use of PET in follow-up were found. CONCLUSION: [(11)C]PIB, Na[(18)F]F and [(18)F]FBP can be used to diagnose cardiac amyloidosis, although [(18)F]FBP may not be suitable for the distinction of different types of amyloid cardiomyopathy. No studies on PET in the follow-up of ATTR amyloidosis patients were found. Future research should focus on the use of these PET tracers in the follow-up of ATTR amyloidosis patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00259-023-06381-3. |
format | Online Article Text |
id | pubmed-10684414 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-106844142023-11-30 Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review Tingen, H. S. A. Tubben, A. van ’t Oever, J. H. Pastoor, E. M. van Zon, P. P. A. Nienhuis, H. L. A. van der Meer, P. Slart, R. H J. A. Eur J Nucl Med Mol Imaging Review Article PURPOSE: Transthyretin (ATTR) amyloidosis is a progressive protein misfolding disease with frequent cardiac involvement. This review aims to determine the value of PET in diagnosis, assessment of disease progression or treatment response and its relation to clinical outcome in follow-up of ATTR amyloid cardiomyopathy (ATTR-CM) patients. METHODS: Medline, Cochrane Library, Embase and Web of Science databases were searched, from the earliest date available until December 2022, for studies investigating the use of PET in ATTR-CM patients. Studies containing original data were included, except for case reports. Risk of bias was assessed by QUADAS-2. RESULTS: Twenty-one studies were included in this systematic review, investigating five different tracers: carbon-11 Pittsburgh compound B ([(11)C]PIB), fluorine-18 Florbetaben ([(18)F]FBB), fluorine-18 Florbetapir ([(18)F]FBP), fluorine-18 Flutemetamol ([(18)F]FMM) and fluorine-18 Sodium Fluoride (Na[(18)F]F). In total 211 ATTR amyloidosis patients were included. A majority of studies concluded that [(11)C]PIB, [(18)F]FBP and Na[(18)F]F can distinguish ATTR amyloidosis patients from controls, and that [(11)C]PIB and Na[(18)F]F, but not [(18)F]FBP, can distinguish ATTR-CM patients from patients with cardiac light chain amyloidosis. Evidence on the performance of [(18)F]FBB and [(18)F]FMM was contradictory. No studies on the use of PET in follow-up were found. CONCLUSION: [(11)C]PIB, Na[(18)F]F and [(18)F]FBP can be used to diagnose cardiac amyloidosis, although [(18)F]FBP may not be suitable for the distinction of different types of amyloid cardiomyopathy. No studies on PET in the follow-up of ATTR amyloidosis patients were found. Future research should focus on the use of these PET tracers in the follow-up of ATTR amyloidosis patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00259-023-06381-3. Springer Berlin Heidelberg 2023-08-10 2023 /pmc/articles/PMC10684414/ /pubmed/37561144 http://dx.doi.org/10.1007/s00259-023-06381-3 Text en © The Author(s) 2023, corrected publication 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Review Article Tingen, H. S. A. Tubben, A. van ’t Oever, J. H. Pastoor, E. M. van Zon, P. P. A. Nienhuis, H. L. A. van der Meer, P. Slart, R. H J. A. Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title | Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title_full | Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title_fullStr | Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title_full_unstemmed | Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title_short | Positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: A systematic review |
title_sort | positron emission tomography in the diagnosis and follow-up of transthyretin amyloid cardiomyopathy patients: a systematic review |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10684414/ https://www.ncbi.nlm.nih.gov/pubmed/37561144 http://dx.doi.org/10.1007/s00259-023-06381-3 |
work_keys_str_mv | AT tingenhsa positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT tubbena positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT vantoeverjh positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT pastoorem positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT vanzonppa positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT nienhuishla positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT vandermeerp positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview AT slartrhja positronemissiontomographyinthediagnosisandfollowupoftransthyretinamyloidcardiomyopathypatientsasystematicreview |