Cargando…
Association between disability in activities of daily living and phase angle in hemodialysis patients
BACKGROUND: Disability in activities of daily living (ADL) significantly increases the risk of mortality among patients undergoing hemodialysis. Malnutrition and decreased exercise capacity are closely correlated with ADL disability. Phase angle (PhA) has been proposed as a measure of nutritional st...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10688067/ https://www.ncbi.nlm.nih.gov/pubmed/38031052 http://dx.doi.org/10.1186/s12882-023-03400-1 |
_version_ | 1785152105061810176 |
---|---|
author | Li, Junhui Wang, Zhi Zhang, Qiannan Zhang, Huiping Shen, Yuxin Zhang, Qi Jian, Guihua Cheng, Dongsheng Wang, Niansong |
author_facet | Li, Junhui Wang, Zhi Zhang, Qiannan Zhang, Huiping Shen, Yuxin Zhang, Qi Jian, Guihua Cheng, Dongsheng Wang, Niansong |
author_sort | Li, Junhui |
collection | PubMed |
description | BACKGROUND: Disability in activities of daily living (ADL) significantly increases the risk of mortality among patients undergoing hemodialysis. Malnutrition and decreased exercise capacity are closely correlated with ADL disability. Phase angle (PhA) has been proposed as a measure of nutritional status and exercise capacity. This study aims to investigate the prevalence of ADL disability in hemodialysis patients and its association with PhA. METHODS: A prospective, observational study was conducted, involving hemodialysis patients treated between November 2019 and January 2020 in an affiliated hospital of Chinese university. ADL was measured using both basic ADL (BADL) scales and instrumental ADL (IADL) scales. PhA measurements were obtained using a BIA device while the patients were in the supine position after dialysis. RESULTS: A total of 237 hemodialysis patients with a mean age of 60.01 ± 13.55 years were included in this study. The prevalence of disability in ADL was 43.5%. Multivariable analysis results showed a robust association between low PhA and disability in both BADL and IADL (for each unit decrease in PhA: odds ratio 4.83 [95% CI: 2.56–9.0], and 3.57 [95% CI: 2.14–5.95], respectively). The optimal cut-off values of PhA for disability in BADL and IADL were 4.8 and 5.4, with the area under the ROC curve (AUC) were 0.783 (0.727, 0.835) and 0.799 (0.743, 0.848), respectively. CONCLUSIONS: Low PhA is strongly associated with disability in ADL in hemodialysis patients. These findings suggest that PhA may serve as a potentially objective measure of ADL disability in hemodialysis patients. |
format | Online Article Text |
id | pubmed-10688067 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-106880672023-11-30 Association between disability in activities of daily living and phase angle in hemodialysis patients Li, Junhui Wang, Zhi Zhang, Qiannan Zhang, Huiping Shen, Yuxin Zhang, Qi Jian, Guihua Cheng, Dongsheng Wang, Niansong BMC Nephrol Research BACKGROUND: Disability in activities of daily living (ADL) significantly increases the risk of mortality among patients undergoing hemodialysis. Malnutrition and decreased exercise capacity are closely correlated with ADL disability. Phase angle (PhA) has been proposed as a measure of nutritional status and exercise capacity. This study aims to investigate the prevalence of ADL disability in hemodialysis patients and its association with PhA. METHODS: A prospective, observational study was conducted, involving hemodialysis patients treated between November 2019 and January 2020 in an affiliated hospital of Chinese university. ADL was measured using both basic ADL (BADL) scales and instrumental ADL (IADL) scales. PhA measurements were obtained using a BIA device while the patients were in the supine position after dialysis. RESULTS: A total of 237 hemodialysis patients with a mean age of 60.01 ± 13.55 years were included in this study. The prevalence of disability in ADL was 43.5%. Multivariable analysis results showed a robust association between low PhA and disability in both BADL and IADL (for each unit decrease in PhA: odds ratio 4.83 [95% CI: 2.56–9.0], and 3.57 [95% CI: 2.14–5.95], respectively). The optimal cut-off values of PhA for disability in BADL and IADL were 4.8 and 5.4, with the area under the ROC curve (AUC) were 0.783 (0.727, 0.835) and 0.799 (0.743, 0.848), respectively. CONCLUSIONS: Low PhA is strongly associated with disability in ADL in hemodialysis patients. These findings suggest that PhA may serve as a potentially objective measure of ADL disability in hemodialysis patients. BioMed Central 2023-11-29 /pmc/articles/PMC10688067/ /pubmed/38031052 http://dx.doi.org/10.1186/s12882-023-03400-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Li, Junhui Wang, Zhi Zhang, Qiannan Zhang, Huiping Shen, Yuxin Zhang, Qi Jian, Guihua Cheng, Dongsheng Wang, Niansong Association between disability in activities of daily living and phase angle in hemodialysis patients |
title | Association between disability in activities of daily living and phase angle in hemodialysis patients |
title_full | Association between disability in activities of daily living and phase angle in hemodialysis patients |
title_fullStr | Association between disability in activities of daily living and phase angle in hemodialysis patients |
title_full_unstemmed | Association between disability in activities of daily living and phase angle in hemodialysis patients |
title_short | Association between disability in activities of daily living and phase angle in hemodialysis patients |
title_sort | association between disability in activities of daily living and phase angle in hemodialysis patients |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10688067/ https://www.ncbi.nlm.nih.gov/pubmed/38031052 http://dx.doi.org/10.1186/s12882-023-03400-1 |
work_keys_str_mv | AT lijunhui associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT wangzhi associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT zhangqiannan associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT zhanghuiping associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT shenyuxin associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT zhangqi associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT jianguihua associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT chengdongsheng associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients AT wangniansong associationbetweendisabilityinactivitiesofdailylivingandphaseangleinhemodialysispatients |