Cargando…
Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10690965/ https://www.ncbi.nlm.nih.gov/pubmed/38041197 http://dx.doi.org/10.1186/s43019-023-00201-6 |
_version_ | 1785152636327034880 |
---|---|
author | Czerwonka, Natalia Gupta, Puneet Desai, Sohil S. Hickernell, Thomas R. Neuwirth, Alexander L. Trofa, David P. |
author_facet | Czerwonka, Natalia Gupta, Puneet Desai, Sohil S. Hickernell, Thomas R. Neuwirth, Alexander L. Trofa, David P. |
author_sort | Czerwonka, Natalia |
collection | PubMed |
description | BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on PROMIS use in total knee arthroplasty patients. METHODS: A systematic search of the Pubmed/MEDLINE and Embase databases was performed according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. Study characteristics, patient demographics, psychometric properties (Pearson and Spearman correlation) with legacy patient-reported outcome measurement (PROM) instruments, floor and ceiling effects, responsiveness, and minimum clinically important difference (MCID) and PROMIS outcomes were recorded and analyzed. RESULTS: Fifteen studies investigating PROMIS in 11,140 patients were included. The weighted-average Pearson correlation coefficient comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.62 [standard error (SE) = 0.06] and the weighted-average Spearman correlation comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.59 (SE = 0.06), demonstrating moderate-to-strong correlation and validity. There were no differences in weighted average floor [0.03% (SE = 3.1) versus 0% (SE = 0.1) versus 0.01% (SE = 1.1); p = 0.25] or ceiling effects [0.01% (SE = 0.7) versus 0.02% (SE = 1.4) versus 0.04% (SE = 3.5); p = 0.36] between PROMIS and legacy instruments. The weighted average for percentage of patients achieving MCID was 59.1% for global physical health (GPH), 26.0% for global mental health (GMH), 52.7% for physical function (PF), 67.2% for pain interference (PI), and 37.2% for depression. CONCLUSION: Notably, PROMIS global physical health, physical function, and pain interference were found to be significantly responsive, with PROMIS pain interference most effectively capturing clinical improvement as evidenced by the achievement of MCID. |
format | Online Article Text |
id | pubmed-10690965 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-106909652023-12-02 Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature Czerwonka, Natalia Gupta, Puneet Desai, Sohil S. Hickernell, Thomas R. Neuwirth, Alexander L. Trofa, David P. Knee Surg Relat Res Review Article BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on PROMIS use in total knee arthroplasty patients. METHODS: A systematic search of the Pubmed/MEDLINE and Embase databases was performed according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. Study characteristics, patient demographics, psychometric properties (Pearson and Spearman correlation) with legacy patient-reported outcome measurement (PROM) instruments, floor and ceiling effects, responsiveness, and minimum clinically important difference (MCID) and PROMIS outcomes were recorded and analyzed. RESULTS: Fifteen studies investigating PROMIS in 11,140 patients were included. The weighted-average Pearson correlation coefficient comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.62 [standard error (SE) = 0.06] and the weighted-average Spearman correlation comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.59 (SE = 0.06), demonstrating moderate-to-strong correlation and validity. There were no differences in weighted average floor [0.03% (SE = 3.1) versus 0% (SE = 0.1) versus 0.01% (SE = 1.1); p = 0.25] or ceiling effects [0.01% (SE = 0.7) versus 0.02% (SE = 1.4) versus 0.04% (SE = 3.5); p = 0.36] between PROMIS and legacy instruments. The weighted average for percentage of patients achieving MCID was 59.1% for global physical health (GPH), 26.0% for global mental health (GMH), 52.7% for physical function (PF), 67.2% for pain interference (PI), and 37.2% for depression. CONCLUSION: Notably, PROMIS global physical health, physical function, and pain interference were found to be significantly responsive, with PROMIS pain interference most effectively capturing clinical improvement as evidenced by the achievement of MCID. BioMed Central 2023-12-01 /pmc/articles/PMC10690965/ /pubmed/38041197 http://dx.doi.org/10.1186/s43019-023-00201-6 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Article Czerwonka, Natalia Gupta, Puneet Desai, Sohil S. Hickernell, Thomas R. Neuwirth, Alexander L. Trofa, David P. Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title | Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title_full | Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title_fullStr | Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title_full_unstemmed | Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title_short | Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
title_sort | patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10690965/ https://www.ncbi.nlm.nih.gov/pubmed/38041197 http://dx.doi.org/10.1186/s43019-023-00201-6 |
work_keys_str_mv | AT czerwonkanatalia patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature AT guptapuneet patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature AT desaisohils patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature AT hickernellthomasr patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature AT neuwirthalexanderl patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature AT trofadavidp patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature |