Cargando…

Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature

BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on...

Descripción completa

Detalles Bibliográficos
Autores principales: Czerwonka, Natalia, Gupta, Puneet, Desai, Sohil S., Hickernell, Thomas R., Neuwirth, Alexander L., Trofa, David P.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10690965/
https://www.ncbi.nlm.nih.gov/pubmed/38041197
http://dx.doi.org/10.1186/s43019-023-00201-6
_version_ 1785152636327034880
author Czerwonka, Natalia
Gupta, Puneet
Desai, Sohil S.
Hickernell, Thomas R.
Neuwirth, Alexander L.
Trofa, David P.
author_facet Czerwonka, Natalia
Gupta, Puneet
Desai, Sohil S.
Hickernell, Thomas R.
Neuwirth, Alexander L.
Trofa, David P.
author_sort Czerwonka, Natalia
collection PubMed
description BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on PROMIS use in total knee arthroplasty patients. METHODS: A systematic search of the Pubmed/MEDLINE and Embase databases was performed according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. Study characteristics, patient demographics, psychometric properties (Pearson and Spearman correlation) with legacy patient-reported outcome measurement (PROM) instruments, floor and ceiling effects, responsiveness, and minimum clinically important difference (MCID) and PROMIS outcomes were recorded and analyzed. RESULTS: Fifteen studies investigating PROMIS in 11,140 patients were included. The weighted-average Pearson correlation coefficient comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.62 [standard error (SE) = 0.06] and the weighted-average Spearman correlation comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.59 (SE = 0.06), demonstrating moderate-to-strong correlation and validity. There were no differences in weighted average floor [0.03% (SE = 3.1) versus 0% (SE = 0.1) versus 0.01% (SE = 1.1); p = 0.25] or ceiling effects [0.01% (SE = 0.7) versus 0.02% (SE = 1.4) versus 0.04% (SE = 3.5); p = 0.36] between PROMIS and legacy instruments. The weighted average for percentage of patients achieving MCID was 59.1% for global physical health (GPH), 26.0% for global mental health (GMH), 52.7% for physical function (PF), 67.2% for pain interference (PI), and 37.2% for depression. CONCLUSION: Notably, PROMIS global physical health, physical function, and pain interference were found to be significantly responsive, with PROMIS pain interference most effectively capturing clinical improvement as evidenced by the achievement of MCID.
format Online
Article
Text
id pubmed-10690965
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-106909652023-12-02 Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature Czerwonka, Natalia Gupta, Puneet Desai, Sohil S. Hickernell, Thomas R. Neuwirth, Alexander L. Trofa, David P. Knee Surg Relat Res Review Article BACKGROUND: The purpose of this study is to provide a systematic review of the literature pertaining to Patient-Reported Outcome Measurement Information System (PROMIS) validation and utilization as an outcomes metric in total knee arthroplasty (TKA) patients. This is the first systematic review on PROMIS use in total knee arthroplasty patients. METHODS: A systematic search of the Pubmed/MEDLINE and Embase databases was performed according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. Study characteristics, patient demographics, psychometric properties (Pearson and Spearman correlation) with legacy patient-reported outcome measurement (PROM) instruments, floor and ceiling effects, responsiveness, and minimum clinically important difference (MCID) and PROMIS outcomes were recorded and analyzed. RESULTS: Fifteen studies investigating PROMIS in 11,140 patients were included. The weighted-average Pearson correlation coefficient comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.62 [standard error (SE) = 0.06] and the weighted-average Spearman correlation comparing PROMIS domains with legacy patient-reported outcome measurements in total knee arthroplasty patients was 0.59 (SE = 0.06), demonstrating moderate-to-strong correlation and validity. There were no differences in weighted average floor [0.03% (SE = 3.1) versus 0% (SE = 0.1) versus 0.01% (SE = 1.1); p = 0.25] or ceiling effects [0.01% (SE = 0.7) versus 0.02% (SE = 1.4) versus 0.04% (SE = 3.5); p = 0.36] between PROMIS and legacy instruments. The weighted average for percentage of patients achieving MCID was 59.1% for global physical health (GPH), 26.0% for global mental health (GMH), 52.7% for physical function (PF), 67.2% for pain interference (PI), and 37.2% for depression. CONCLUSION: Notably, PROMIS global physical health, physical function, and pain interference were found to be significantly responsive, with PROMIS pain interference most effectively capturing clinical improvement as evidenced by the achievement of MCID. BioMed Central 2023-12-01 /pmc/articles/PMC10690965/ /pubmed/38041197 http://dx.doi.org/10.1186/s43019-023-00201-6 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review Article
Czerwonka, Natalia
Gupta, Puneet
Desai, Sohil S.
Hickernell, Thomas R.
Neuwirth, Alexander L.
Trofa, David P.
Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title_full Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title_fullStr Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title_full_unstemmed Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title_short Patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
title_sort patient-reported outcomes measurement information system instruments in knee arthroplasty patients: a systematic review of the literature
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10690965/
https://www.ncbi.nlm.nih.gov/pubmed/38041197
http://dx.doi.org/10.1186/s43019-023-00201-6
work_keys_str_mv AT czerwonkanatalia patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature
AT guptapuneet patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature
AT desaisohils patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature
AT hickernellthomasr patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature
AT neuwirthalexanderl patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature
AT trofadavidp patientreportedoutcomesmeasurementinformationsysteminstrumentsinkneearthroplastypatientsasystematicreviewoftheliterature