Cargando…

Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo

BACKGROUND: In Togo, malaria remains a major public health problem, and the management of suspected cases requires confirmation with appropriate biological methods. Malaria diagnosis has been improved by the introduction of rapid diagnostic tests (RDTs), recommended by the World Health Organization...

Descripción completa

Detalles Bibliográficos
Autores principales: Teou, Diwaba Carmel, Dorkenoo, Ameyo Monique, Ataba, Essoham, Alidou, Smaila, Yakpa, Kossi, Abdou-Kerim, Agueregna, Maman, Issaka, Agbonon, Amegnona
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10691072/
https://www.ncbi.nlm.nih.gov/pubmed/38037186
http://dx.doi.org/10.1186/s13071-023-06062-y
_version_ 1785152662944088064
author Teou, Diwaba Carmel
Dorkenoo, Ameyo Monique
Ataba, Essoham
Alidou, Smaila
Yakpa, Kossi
Abdou-Kerim, Agueregna
Maman, Issaka
Agbonon, Amegnona
author_facet Teou, Diwaba Carmel
Dorkenoo, Ameyo Monique
Ataba, Essoham
Alidou, Smaila
Yakpa, Kossi
Abdou-Kerim, Agueregna
Maman, Issaka
Agbonon, Amegnona
author_sort Teou, Diwaba Carmel
collection PubMed
description BACKGROUND: In Togo, malaria remains a major public health problem, and the management of suspected cases requires confirmation with appropriate biological methods. Malaria diagnosis has been improved by the introduction of rapid diagnostic tests (RDTs), recommended by the World Health Organization (WHO) for areas where microscopy is not available. To be used, these RDTs must meet performance criteria defined by the WHO. This study was conducted to evaluate the diagnostic performance of two RDTs: Advantage P.f. Malaria Card(®) detecting HRP2 antigen and Advantage Malaria Pan + Pf Card(®) detecting both HRP2 and pLDH antigens. METHODS: This was a cross-sectional analytical study conducted from December 2019 to February 2020 on malaria-suspected cases received in three sentinel sites in Togo and from whom capillary blood was collected to perform the two RDTs according to the manufacturer's instructions. Sensitivity and specificity were estimated by comparing to thick/thin blood smear, the gold standard, and to PCR, which is a more sensitive. RESULTS: A total of 390 participants (54.9% female) with a median age of 18 (± 0.8) years were included in the study. The sensitivity of both Advantage P.f. Malaria Card® and Advantage Malaria Pan + Pf Card(®) compared to thick/thin blood smear was 91.8% and 91.3%, respectively, and for both the specificity was 94.7%. Compared to PCR, the sensitivity was 84.2% and 83.8%, respectively, and the specificity 96.5%. CONCLUSIONS: The performances of the Advantage P.f. Malaria Card(®) and Advantage Malaria PAN + Pf Card(®) compared to microscopy, considered the gold standard, were acceptable under the field conditions found in Togo. They can therefore be used for the biological diagnosis of malaria. GRAPHICAL ABSTRACT: [Image: see text]
format Online
Article
Text
id pubmed-10691072
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-106910722023-12-02 Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo Teou, Diwaba Carmel Dorkenoo, Ameyo Monique Ataba, Essoham Alidou, Smaila Yakpa, Kossi Abdou-Kerim, Agueregna Maman, Issaka Agbonon, Amegnona Parasit Vectors Research BACKGROUND: In Togo, malaria remains a major public health problem, and the management of suspected cases requires confirmation with appropriate biological methods. Malaria diagnosis has been improved by the introduction of rapid diagnostic tests (RDTs), recommended by the World Health Organization (WHO) for areas where microscopy is not available. To be used, these RDTs must meet performance criteria defined by the WHO. This study was conducted to evaluate the diagnostic performance of two RDTs: Advantage P.f. Malaria Card(®) detecting HRP2 antigen and Advantage Malaria Pan + Pf Card(®) detecting both HRP2 and pLDH antigens. METHODS: This was a cross-sectional analytical study conducted from December 2019 to February 2020 on malaria-suspected cases received in three sentinel sites in Togo and from whom capillary blood was collected to perform the two RDTs according to the manufacturer's instructions. Sensitivity and specificity were estimated by comparing to thick/thin blood smear, the gold standard, and to PCR, which is a more sensitive. RESULTS: A total of 390 participants (54.9% female) with a median age of 18 (± 0.8) years were included in the study. The sensitivity of both Advantage P.f. Malaria Card® and Advantage Malaria Pan + Pf Card(®) compared to thick/thin blood smear was 91.8% and 91.3%, respectively, and for both the specificity was 94.7%. Compared to PCR, the sensitivity was 84.2% and 83.8%, respectively, and the specificity 96.5%. CONCLUSIONS: The performances of the Advantage P.f. Malaria Card(®) and Advantage Malaria PAN + Pf Card(®) compared to microscopy, considered the gold standard, were acceptable under the field conditions found in Togo. They can therefore be used for the biological diagnosis of malaria. GRAPHICAL ABSTRACT: [Image: see text] BioMed Central 2023-11-30 /pmc/articles/PMC10691072/ /pubmed/38037186 http://dx.doi.org/10.1186/s13071-023-06062-y Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Teou, Diwaba Carmel
Dorkenoo, Ameyo Monique
Ataba, Essoham
Alidou, Smaila
Yakpa, Kossi
Abdou-Kerim, Agueregna
Maman, Issaka
Agbonon, Amegnona
Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title_full Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title_fullStr Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title_full_unstemmed Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title_short Evaluation of the performance of advantage P.f. malaria Card(®) and advantage malaria Pan + Pf Card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in Togo
title_sort evaluation of the performance of advantage p.f. malaria card(®) and advantage malaria pan + pf card(®), two rapid diagnostic tests for parasitological confirmation of malaria cases in field situation in togo
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10691072/
https://www.ncbi.nlm.nih.gov/pubmed/38037186
http://dx.doi.org/10.1186/s13071-023-06062-y
work_keys_str_mv AT teoudiwabacarmel evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT dorkenooameyomonique evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT atabaessoham evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT alidousmaila evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT yakpakossi evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT abdoukerimagueregna evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT mamanissaka evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo
AT agbononamegnona evaluationoftheperformanceofadvantagepfmalariacardandadvantagemalariapanpfcardtworapiddiagnostictestsforparasitologicalconfirmationofmalariacasesinfieldsituationintogo