Cargando…
Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review
BACKGROUND: Inequities of health outcomes persist in rural populations globally. This is strongly associated with there being less health coverage in rural and underserviced areas. Increasing health care coverage in rural area requires rural health system strengthening, which subsequently necessitat...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10694960/ http://dx.doi.org/10.1186/s12961-023-01078-3 |
_version_ | 1785153489873141760 |
---|---|
author | Pamungkas, Dewi Retno O’Sullivan, Belinda McGrail, Matthew Chater, Bruce |
author_facet | Pamungkas, Dewi Retno O’Sullivan, Belinda McGrail, Matthew Chater, Bruce |
author_sort | Pamungkas, Dewi Retno |
collection | PubMed |
description | BACKGROUND: Inequities of health outcomes persist in rural populations globally. This is strongly associated with there being less health coverage in rural and underserviced areas. Increasing health care coverage in rural area requires rural health system strengthening, which subsequently necessitates having tools to guide action. OBJECTIVE: This mapping review aimed to describe the range of tools, frameworks and resources (hereafter called tools) available globally for rural health system capacity building. METHODS: This study collected peer-reviewed materials published in 15-year period (2005–2020). A systematic mapping review process identified 149 articles for inclusion, related to 144 tools that had been developed, implemented, and/or evaluated (some tools reported over multiple articles) which were mapped against the World Health Organization’s (WHO’s) six health system building blocks (agreed as the elements that need to be addressed to strengthen health systems). RESULTS: The majority of tools were from high- and middle-income countries (n = 85, 59% and n = 43, 29%, respectively), and only 17 tools (12%) from low-income countries. Most tools related to the health service building block (n = 57, 39%), or workforce (n = 33, 23%). There were a few tools related to information and leadership and governance (n = 8, 5% each). Very few tools related to infrastructure (n = 3, 2%) and financing (n = 4, 3%). This mapping review also provided broad quality appraisal, showing that the majority of the tools had been evaluated or validated, or both (n = 106, 74%). CONCLUSION: This mapping review provides evidence that there is a breadth of tools available for health system strengthening globally along with some gaps where no tools were identified for specific health system building blocks. Furthermore, most tools were developed and applied in HIC/MIC and it is important to consider factors that influence their utility in LMIC settings. It may be important to develop new tools related to infrastructure and financing. Tools that have been positively evaluated should be made available to all rural communities, to ensure comprehensive global action on rural health system strengthening. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12961-023-01078-3. |
format | Online Article Text |
id | pubmed-10694960 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-106949602023-12-05 Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review Pamungkas, Dewi Retno O’Sullivan, Belinda McGrail, Matthew Chater, Bruce Health Res Policy Syst Review BACKGROUND: Inequities of health outcomes persist in rural populations globally. This is strongly associated with there being less health coverage in rural and underserviced areas. Increasing health care coverage in rural area requires rural health system strengthening, which subsequently necessitates having tools to guide action. OBJECTIVE: This mapping review aimed to describe the range of tools, frameworks and resources (hereafter called tools) available globally for rural health system capacity building. METHODS: This study collected peer-reviewed materials published in 15-year period (2005–2020). A systematic mapping review process identified 149 articles for inclusion, related to 144 tools that had been developed, implemented, and/or evaluated (some tools reported over multiple articles) which were mapped against the World Health Organization’s (WHO’s) six health system building blocks (agreed as the elements that need to be addressed to strengthen health systems). RESULTS: The majority of tools were from high- and middle-income countries (n = 85, 59% and n = 43, 29%, respectively), and only 17 tools (12%) from low-income countries. Most tools related to the health service building block (n = 57, 39%), or workforce (n = 33, 23%). There were a few tools related to information and leadership and governance (n = 8, 5% each). Very few tools related to infrastructure (n = 3, 2%) and financing (n = 4, 3%). This mapping review also provided broad quality appraisal, showing that the majority of the tools had been evaluated or validated, or both (n = 106, 74%). CONCLUSION: This mapping review provides evidence that there is a breadth of tools available for health system strengthening globally along with some gaps where no tools were identified for specific health system building blocks. Furthermore, most tools were developed and applied in HIC/MIC and it is important to consider factors that influence their utility in LMIC settings. It may be important to develop new tools related to infrastructure and financing. Tools that have been positively evaluated should be made available to all rural communities, to ensure comprehensive global action on rural health system strengthening. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12961-023-01078-3. BioMed Central 2023-12-04 /pmc/articles/PMC10694960/ http://dx.doi.org/10.1186/s12961-023-01078-3 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Pamungkas, Dewi Retno O’Sullivan, Belinda McGrail, Matthew Chater, Bruce Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title | Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title_full | Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title_fullStr | Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title_full_unstemmed | Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title_short | Tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
title_sort | tools, frameworks and resources to guide global action on strengthening rural health systems: a mapping review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10694960/ http://dx.doi.org/10.1186/s12961-023-01078-3 |
work_keys_str_mv | AT pamungkasdewiretno toolsframeworksandresourcestoguideglobalactiononstrengtheningruralhealthsystemsamappingreview AT osullivanbelinda toolsframeworksandresourcestoguideglobalactiononstrengtheningruralhealthsystemsamappingreview AT mcgrailmatthew toolsframeworksandresourcestoguideglobalactiononstrengtheningruralhealthsystemsamappingreview AT chaterbruce toolsframeworksandresourcestoguideglobalactiononstrengtheningruralhealthsystemsamappingreview |