Cargando…

Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1

In this study, we clarified the molecular mechanism(s) underlying the regulation of matrix metalloproteinase (MMP)-1 gene by hepatocyte growth factor (HGF) in cultured human dermal fibroblasts. HGF induced MMP-1 protein as well as mRNA at a transcriptional level via extracellular signal-regulated ki...

Descripción completa

Detalles Bibliográficos
Autores principales: Jinnin, Masatoshi, Ihn, Hironobu, Mimura, Yoshihiro, Asano, Yoshihide, Yamane, Kenichi, Tamaki, Kunihiko
Formato: Texto
Lenguaje:English
Publicado: Oxford University Press 2005
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1156961/
https://www.ncbi.nlm.nih.gov/pubmed/15972796
http://dx.doi.org/10.1093/nar/gki648
_version_ 1782124345680723968
author Jinnin, Masatoshi
Ihn, Hironobu
Mimura, Yoshihiro
Asano, Yoshihide
Yamane, Kenichi
Tamaki, Kunihiko
author_facet Jinnin, Masatoshi
Ihn, Hironobu
Mimura, Yoshihiro
Asano, Yoshihide
Yamane, Kenichi
Tamaki, Kunihiko
author_sort Jinnin, Masatoshi
collection PubMed
description In this study, we clarified the molecular mechanism(s) underlying the regulation of matrix metalloproteinase (MMP)-1 gene by hepatocyte growth factor (HGF) in cultured human dermal fibroblasts. HGF induced MMP-1 protein as well as mRNA at a transcriptional level via extracellular signal-regulated kinase (ERK) signaling pathway. The region in the MMP-1 promoter mediating the inducible responsiveness to HGF, defined by the transient transfection analysis of the serial 5′ deletion constructs, contained an Ets binding site. Mutation of this Ets binding site abrogated the HGF-inducible promoter activity. Ets1 up-regulated the expression of MMP-1 promoter activity, whereas Fli1 had antagonistic effects on them. After HGF treatment, the protein level and the binding activity of Ets1 was increased and those of Fli1 was decreased, which were canceled by PD98059. These results suggest that HGF up-regulates MMP-1 expression via ERK signaling pathway through the balance of Ets1 and Fli1, which may be a novel mechanism of regulating MMP-1 gene expression.
format Text
id pubmed-1156961
institution National Center for Biotechnology Information
language English
publishDate 2005
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-11569612005-06-22 Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1 Jinnin, Masatoshi Ihn, Hironobu Mimura, Yoshihiro Asano, Yoshihide Yamane, Kenichi Tamaki, Kunihiko Nucleic Acids Res Article In this study, we clarified the molecular mechanism(s) underlying the regulation of matrix metalloproteinase (MMP)-1 gene by hepatocyte growth factor (HGF) in cultured human dermal fibroblasts. HGF induced MMP-1 protein as well as mRNA at a transcriptional level via extracellular signal-regulated kinase (ERK) signaling pathway. The region in the MMP-1 promoter mediating the inducible responsiveness to HGF, defined by the transient transfection analysis of the serial 5′ deletion constructs, contained an Ets binding site. Mutation of this Ets binding site abrogated the HGF-inducible promoter activity. Ets1 up-regulated the expression of MMP-1 promoter activity, whereas Fli1 had antagonistic effects on them. After HGF treatment, the protein level and the binding activity of Ets1 was increased and those of Fli1 was decreased, which were canceled by PD98059. These results suggest that HGF up-regulates MMP-1 expression via ERK signaling pathway through the balance of Ets1 and Fli1, which may be a novel mechanism of regulating MMP-1 gene expression. Oxford University Press 2005 2005-06-21 /pmc/articles/PMC1156961/ /pubmed/15972796 http://dx.doi.org/10.1093/nar/gki648 Text en © The Author 2005. Published by Oxford University Press. All rights reserved
spellingShingle Article
Jinnin, Masatoshi
Ihn, Hironobu
Mimura, Yoshihiro
Asano, Yoshihide
Yamane, Kenichi
Tamaki, Kunihiko
Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title_full Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title_fullStr Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title_full_unstemmed Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title_short Matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via ERK signaling pathway involves Ets1 and Fli1
title_sort matrix metalloproteinase-1 up-regulation by hepatocyte growth factor in human dermal fibroblasts via erk signaling pathway involves ets1 and fli1
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1156961/
https://www.ncbi.nlm.nih.gov/pubmed/15972796
http://dx.doi.org/10.1093/nar/gki648
work_keys_str_mv AT jinninmasatoshi matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1
AT ihnhironobu matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1
AT mimurayoshihiro matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1
AT asanoyoshihide matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1
AT yamanekenichi matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1
AT tamakikunihiko matrixmetalloproteinase1upregulationbyhepatocytegrowthfactorinhumandermalfibroblastsviaerksignalingpathwayinvolvesets1andfli1