Cargando…
Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic
Changes in the synaptic connection strengths between neurons are believed to play a role in memory formation. An important mechanism for changing synaptic strength is through movement of neurotransmitter receptors and regulatory proteins to and from the synapse. Several activity-triggered biochemica...
Autores principales: | , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2005
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1185646/ https://www.ncbi.nlm.nih.gov/pubmed/16110334 http://dx.doi.org/10.1371/journal.pcbi.0010020 |
_version_ | 1782124746452762624 |
---|---|
author | Hayer, Arnold Bhalla, Upinder S |
author_facet | Hayer, Arnold Bhalla, Upinder S |
author_sort | Hayer, Arnold |
collection | PubMed |
description | Changes in the synaptic connection strengths between neurons are believed to play a role in memory formation. An important mechanism for changing synaptic strength is through movement of neurotransmitter receptors and regulatory proteins to and from the synapse. Several activity-triggered biochemical events control these movements. Here we use computer models to explore how these putative memory-related changes can be stabilised long after the initial trigger, and beyond the lifetime of synaptic molecules. We base our models on published biochemical data and experiments on the activity-dependent movement of a glutamate receptor, AMPAR, and a calcium-dependent kinase, CaMKII. We find that both of these molecules participate in distinct bistable switches. These simulated switches are effective for long periods despite molecular turnover and biochemical fluctuations arising from the small numbers of molecules in the synapse. The AMPAR switch arises from a novel self-recruitment process where the presence of sufficient receptors biases the receptor movement cycle to insert still more receptors into the synapse. The CaMKII switch arises from autophosphorylation of the kinase. The switches may function in a tightly coupled manner, or relatively independently. The latter case leads to multiple stable states of the synapse. We propose that similar self-recruitment cycles may be important for maintaining levels of many molecules that undergo regulated movement, and that these may lead to combinatorial possible stable states of systems like the synapse. |
format | Text |
id | pubmed-1185646 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2005 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-11856462005-08-17 Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic Hayer, Arnold Bhalla, Upinder S PLoS Comput Biol Research Article Changes in the synaptic connection strengths between neurons are believed to play a role in memory formation. An important mechanism for changing synaptic strength is through movement of neurotransmitter receptors and regulatory proteins to and from the synapse. Several activity-triggered biochemical events control these movements. Here we use computer models to explore how these putative memory-related changes can be stabilised long after the initial trigger, and beyond the lifetime of synaptic molecules. We base our models on published biochemical data and experiments on the activity-dependent movement of a glutamate receptor, AMPAR, and a calcium-dependent kinase, CaMKII. We find that both of these molecules participate in distinct bistable switches. These simulated switches are effective for long periods despite molecular turnover and biochemical fluctuations arising from the small numbers of molecules in the synapse. The AMPAR switch arises from a novel self-recruitment process where the presence of sufficient receptors biases the receptor movement cycle to insert still more receptors into the synapse. The CaMKII switch arises from autophosphorylation of the kinase. The switches may function in a tightly coupled manner, or relatively independently. The latter case leads to multiple stable states of the synapse. We propose that similar self-recruitment cycles may be important for maintaining levels of many molecules that undergo regulated movement, and that these may lead to combinatorial possible stable states of systems like the synapse. Public Library of Science 2005-07 2005-07-29 /pmc/articles/PMC1185646/ /pubmed/16110334 http://dx.doi.org/10.1371/journal.pcbi.0010020 Text en Copyright: © 2005 Hayer and Bhalla. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Hayer, Arnold Bhalla, Upinder S Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title | Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title_full | Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title_fullStr | Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title_full_unstemmed | Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title_short | Molecular Switches at the Synapse Emerge from Receptor and Kinase Traffic |
title_sort | molecular switches at the synapse emerge from receptor and kinase traffic |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1185646/ https://www.ncbi.nlm.nih.gov/pubmed/16110334 http://dx.doi.org/10.1371/journal.pcbi.0010020 |
work_keys_str_mv | AT hayerarnold molecularswitchesatthesynapseemergefromreceptorandkinasetraffic AT bhallaupinders molecularswitchesatthesynapseemergefromreceptorandkinasetraffic |