Cargando…
Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygo...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Ivyspring International Publisher
2007
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1796949/ https://www.ncbi.nlm.nih.gov/pubmed/17304340 |
_version_ | 1782132275012435968 |
---|---|
author | Cameron, D. Joshua Tong, Zongzhong Yang, Zhenglin Kaminoh, Jack Kamiyah, Shin Chen, Haoyu Zeng, Jiexi Chen, Yali Luo, Ling Zhang, Kang |
author_facet | Cameron, D. Joshua Tong, Zongzhong Yang, Zhenglin Kaminoh, Jack Kamiyah, Shin Chen, Haoyu Zeng, Jiexi Chen, Yali Luo, Ling Zhang, Kang |
author_sort | Cameron, D. Joshua |
collection | PubMed |
description | Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygous Elovl4 knockout mice in order to better understand the function or role of Elovl4. We found that mice lacking a functional Elovl4 protein died perinatally. The cause of death appears to be from dehydration due to faulty permeability barrier formation in the skin. Further biochemical analysis revealed a significant reduction in free fatty acids longer than C26 in homozygous mutant and knockout mouse skin. These results implicate the importance of these long chain fatty acids in skin barrier development. Furthermore, we suggest that Elovl4 is likely involved in the elongation of C26 and longer fatty acids. |
format | Text |
id | pubmed-1796949 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2007 |
publisher | Ivyspring International Publisher |
record_format | MEDLINE/PubMed |
spelling | pubmed-17969492007-02-15 Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival Cameron, D. Joshua Tong, Zongzhong Yang, Zhenglin Kaminoh, Jack Kamiyah, Shin Chen, Haoyu Zeng, Jiexi Chen, Yali Luo, Ling Zhang, Kang Int J Biol Sci Research Paper Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygous Elovl4 knockout mice in order to better understand the function or role of Elovl4. We found that mice lacking a functional Elovl4 protein died perinatally. The cause of death appears to be from dehydration due to faulty permeability barrier formation in the skin. Further biochemical analysis revealed a significant reduction in free fatty acids longer than C26 in homozygous mutant and knockout mouse skin. These results implicate the importance of these long chain fatty acids in skin barrier development. Furthermore, we suggest that Elovl4 is likely involved in the elongation of C26 and longer fatty acids. Ivyspring International Publisher 2007-02-06 /pmc/articles/PMC1796949/ /pubmed/17304340 Text en © Ivyspring International Publisher. This is an open access article. Reproduction is permitted for personal, noncommerical use, provided that the article is in whole, unmodified, and properly cited. |
spellingShingle | Research Paper Cameron, D. Joshua Tong, Zongzhong Yang, Zhenglin Kaminoh, Jack Kamiyah, Shin Chen, Haoyu Zeng, Jiexi Chen, Yali Luo, Ling Zhang, Kang Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title | Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title_full | Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title_fullStr | Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title_full_unstemmed | Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title_short | Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
title_sort | essential role of elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1796949/ https://www.ncbi.nlm.nih.gov/pubmed/17304340 |
work_keys_str_mv | AT camerondjoshua essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT tongzongzhong essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT yangzhenglin essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT kaminohjack essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT kamiyahshin essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT chenhaoyu essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT zengjiexi essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT chenyali essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT luoling essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival AT zhangkang essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival |