Cargando…

Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival

Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygo...

Descripción completa

Detalles Bibliográficos
Autores principales: Cameron, D. Joshua, Tong, Zongzhong, Yang, Zhenglin, Kaminoh, Jack, Kamiyah, Shin, Chen, Haoyu, Zeng, Jiexi, Chen, Yali, Luo, Ling, Zhang, Kang
Formato: Texto
Lenguaje:English
Publicado: Ivyspring International Publisher 2007
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1796949/
https://www.ncbi.nlm.nih.gov/pubmed/17304340
_version_ 1782132275012435968
author Cameron, D. Joshua
Tong, Zongzhong
Yang, Zhenglin
Kaminoh, Jack
Kamiyah, Shin
Chen, Haoyu
Zeng, Jiexi
Chen, Yali
Luo, Ling
Zhang, Kang
author_facet Cameron, D. Joshua
Tong, Zongzhong
Yang, Zhenglin
Kaminoh, Jack
Kamiyah, Shin
Chen, Haoyu
Zeng, Jiexi
Chen, Yali
Luo, Ling
Zhang, Kang
author_sort Cameron, D. Joshua
collection PubMed
description Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygous Elovl4 knockout mice in order to better understand the function or role of Elovl4. We found that mice lacking a functional Elovl4 protein died perinatally. The cause of death appears to be from dehydration due to faulty permeability barrier formation in the skin. Further biochemical analysis revealed a significant reduction in free fatty acids longer than C26 in homozygous mutant and knockout mouse skin. These results implicate the importance of these long chain fatty acids in skin barrier development. Furthermore, we suggest that Elovl4 is likely involved in the elongation of C26 and longer fatty acids.
format Text
id pubmed-1796949
institution National Center for Biotechnology Information
language English
publishDate 2007
publisher Ivyspring International Publisher
record_format MEDLINE/PubMed
spelling pubmed-17969492007-02-15 Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival Cameron, D. Joshua Tong, Zongzhong Yang, Zhenglin Kaminoh, Jack Kamiyah, Shin Chen, Haoyu Zeng, Jiexi Chen, Yali Luo, Ling Zhang, Kang Int J Biol Sci Research Paper Mutations in the gene ELOVL4 have been shown to cause stargardt-like macular dystrophy. ELOVL4 is part of a family of fatty acid elongases and is yet to have a specific elongase activity assigned to it. We generated Elovl4 Y270X mutant mice and characterized the homozygous mutant as well as homozygous Elovl4 knockout mice in order to better understand the function or role of Elovl4. We found that mice lacking a functional Elovl4 protein died perinatally. The cause of death appears to be from dehydration due to faulty permeability barrier formation in the skin. Further biochemical analysis revealed a significant reduction in free fatty acids longer than C26 in homozygous mutant and knockout mouse skin. These results implicate the importance of these long chain fatty acids in skin barrier development. Furthermore, we suggest that Elovl4 is likely involved in the elongation of C26 and longer fatty acids. Ivyspring International Publisher 2007-02-06 /pmc/articles/PMC1796949/ /pubmed/17304340 Text en © Ivyspring International Publisher. This is an open access article. Reproduction is permitted for personal, noncommerical use, provided that the article is in whole, unmodified, and properly cited.
spellingShingle Research Paper
Cameron, D. Joshua
Tong, Zongzhong
Yang, Zhenglin
Kaminoh, Jack
Kamiyah, Shin
Chen, Haoyu
Zeng, Jiexi
Chen, Yali
Luo, Ling
Zhang, Kang
Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title_full Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title_fullStr Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title_full_unstemmed Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title_short Essential role of Elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
title_sort essential role of elovl4 in very long chain fatty acid synthesis, skin permeability barrier function, and neonatal survival
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1796949/
https://www.ncbi.nlm.nih.gov/pubmed/17304340
work_keys_str_mv AT camerondjoshua essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT tongzongzhong essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT yangzhenglin essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT kaminohjack essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT kamiyahshin essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT chenhaoyu essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT zengjiexi essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT chenyali essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT luoling essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival
AT zhangkang essentialroleofelovl4inverylongchainfattyacidsynthesisskinpermeabilitybarrierfunctionandneonatalsurvival