Cargando…
Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB...
Autores principales: | , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
The Rockefeller University Press
2007
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2118523/ https://www.ncbi.nlm.nih.gov/pubmed/17998392 http://dx.doi.org/10.1084/jem.20071391 |
_version_ | 1782141045993111552 |
---|---|
author | Zhou, Joseph S. Xing, Wei Friend, Daniel S. Austen, K. Frank Katz, Howard R. |
author_facet | Zhou, Joseph S. Xing, Wei Friend, Daniel S. Austen, K. Frank Katz, Howard R. |
author_sort | Zhou, Joseph S. |
collection | PubMed |
description | We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4; formerly gp49B1) in a neutrophil-dependent manner. Because both mast cells and neutrophils express LILRB4, we sought a mast cell requirement with mast cell–deficient mouse strains, but unexpectedly obtained full arthritis in Kit(W-sh) mice and full resistance in Kit(W/KitW-v) mice. Kit(W-sh) mice were indeed mast cell deficient as assessed by histology and the absence of IgE/mast cell–dependent passive cutaneous anaphylaxis in the ear and joint as well as passive systemic anaphylaxis. Deletion of LILRB4 in Kit(W-sh) mice exacerbated anti-collagen/LPS-induced joint swelling that was abolished by neutrophil depletion, establishing a counterregulatory role for LILRB4 in the absence of mast cells. Whereas blood neutrophil levels and LPS-elicited tissue neutrophilia were equal in Kit(W-sh) and Kit(+) mice, both were impaired in Kit(W/KitW-v) mice. Although both strains are mast cell deficient and protected from IgE-mediated anaphylactic reactions, their dramatically different responses to autoantibody-mediated, neutrophil-dependent immune complex arthritis suggest that other host differences determine the extent of mast cell involvement. Thus, a conclusion for an absolute mast cell role in a pathobiologic process requires evidence from both strains. |
format | Text |
id | pubmed-2118523 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2007 |
publisher | The Rockefeller University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-21185232008-05-26 Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis Zhou, Joseph S. Xing, Wei Friend, Daniel S. Austen, K. Frank Katz, Howard R. J Exp Med Brief Definitive Reports We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4; formerly gp49B1) in a neutrophil-dependent manner. Because both mast cells and neutrophils express LILRB4, we sought a mast cell requirement with mast cell–deficient mouse strains, but unexpectedly obtained full arthritis in Kit(W-sh) mice and full resistance in Kit(W/KitW-v) mice. Kit(W-sh) mice were indeed mast cell deficient as assessed by histology and the absence of IgE/mast cell–dependent passive cutaneous anaphylaxis in the ear and joint as well as passive systemic anaphylaxis. Deletion of LILRB4 in Kit(W-sh) mice exacerbated anti-collagen/LPS-induced joint swelling that was abolished by neutrophil depletion, establishing a counterregulatory role for LILRB4 in the absence of mast cells. Whereas blood neutrophil levels and LPS-elicited tissue neutrophilia were equal in Kit(W-sh) and Kit(+) mice, both were impaired in Kit(W/KitW-v) mice. Although both strains are mast cell deficient and protected from IgE-mediated anaphylactic reactions, their dramatically different responses to autoantibody-mediated, neutrophil-dependent immune complex arthritis suggest that other host differences determine the extent of mast cell involvement. Thus, a conclusion for an absolute mast cell role in a pathobiologic process requires evidence from both strains. The Rockefeller University Press 2007-11-26 /pmc/articles/PMC2118523/ /pubmed/17998392 http://dx.doi.org/10.1084/jem.20071391 Text en Copyright © 2007, The Rockefeller University Press This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 4.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/4.0/). |
spellingShingle | Brief Definitive Reports Zhou, Joseph S. Xing, Wei Friend, Daniel S. Austen, K. Frank Katz, Howard R. Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title | Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title_full | Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title_fullStr | Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title_full_unstemmed | Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title_short | Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis |
title_sort | mast cell deficiency in kit(w-sh) mice does not impair antibody-mediated arthritis |
topic | Brief Definitive Reports |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2118523/ https://www.ncbi.nlm.nih.gov/pubmed/17998392 http://dx.doi.org/10.1084/jem.20071391 |
work_keys_str_mv | AT zhoujosephs mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis AT xingwei mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis AT frienddaniels mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis AT austenkfrank mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis AT katzhowardr mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis |