Cargando…

Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis

We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Joseph S., Xing, Wei, Friend, Daniel S., Austen, K. Frank, Katz, Howard R.
Formato: Texto
Lenguaje:English
Publicado: The Rockefeller University Press 2007
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2118523/
https://www.ncbi.nlm.nih.gov/pubmed/17998392
http://dx.doi.org/10.1084/jem.20071391
_version_ 1782141045993111552
author Zhou, Joseph S.
Xing, Wei
Friend, Daniel S.
Austen, K. Frank
Katz, Howard R.
author_facet Zhou, Joseph S.
Xing, Wei
Friend, Daniel S.
Austen, K. Frank
Katz, Howard R.
author_sort Zhou, Joseph S.
collection PubMed
description We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4; formerly gp49B1) in a neutrophil-dependent manner. Because both mast cells and neutrophils express LILRB4, we sought a mast cell requirement with mast cell–deficient mouse strains, but unexpectedly obtained full arthritis in Kit(W-sh) mice and full resistance in Kit(W/KitW-v) mice. Kit(W-sh) mice were indeed mast cell deficient as assessed by histology and the absence of IgE/mast cell–dependent passive cutaneous anaphylaxis in the ear and joint as well as passive systemic anaphylaxis. Deletion of LILRB4 in Kit(W-sh) mice exacerbated anti-collagen/LPS-induced joint swelling that was abolished by neutrophil depletion, establishing a counterregulatory role for LILRB4 in the absence of mast cells. Whereas blood neutrophil levels and LPS-elicited tissue neutrophilia were equal in Kit(W-sh) and Kit(+) mice, both were impaired in Kit(W/KitW-v) mice. Although both strains are mast cell deficient and protected from IgE-mediated anaphylactic reactions, their dramatically different responses to autoantibody-mediated, neutrophil-dependent immune complex arthritis suggest that other host differences determine the extent of mast cell involvement. Thus, a conclusion for an absolute mast cell role in a pathobiologic process requires evidence from both strains.
format Text
id pubmed-2118523
institution National Center for Biotechnology Information
language English
publishDate 2007
publisher The Rockefeller University Press
record_format MEDLINE/PubMed
spelling pubmed-21185232008-05-26 Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis Zhou, Joseph S. Xing, Wei Friend, Daniel S. Austen, K. Frank Katz, Howard R. J Exp Med Brief Definitive Reports We previously reported that joint swelling, synovial thickening, and cartilage matrix depletion induced by the injection of anti-collagen monoclonal antibodies and lipopolysaccharide (LPS) in BALB/c mice are increased in the absence of inhibitory leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4; formerly gp49B1) in a neutrophil-dependent manner. Because both mast cells and neutrophils express LILRB4, we sought a mast cell requirement with mast cell–deficient mouse strains, but unexpectedly obtained full arthritis in Kit(W-sh) mice and full resistance in Kit(W/KitW-v) mice. Kit(W-sh) mice were indeed mast cell deficient as assessed by histology and the absence of IgE/mast cell–dependent passive cutaneous anaphylaxis in the ear and joint as well as passive systemic anaphylaxis. Deletion of LILRB4 in Kit(W-sh) mice exacerbated anti-collagen/LPS-induced joint swelling that was abolished by neutrophil depletion, establishing a counterregulatory role for LILRB4 in the absence of mast cells. Whereas blood neutrophil levels and LPS-elicited tissue neutrophilia were equal in Kit(W-sh) and Kit(+) mice, both were impaired in Kit(W/KitW-v) mice. Although both strains are mast cell deficient and protected from IgE-mediated anaphylactic reactions, their dramatically different responses to autoantibody-mediated, neutrophil-dependent immune complex arthritis suggest that other host differences determine the extent of mast cell involvement. Thus, a conclusion for an absolute mast cell role in a pathobiologic process requires evidence from both strains. The Rockefeller University Press 2007-11-26 /pmc/articles/PMC2118523/ /pubmed/17998392 http://dx.doi.org/10.1084/jem.20071391 Text en Copyright © 2007, The Rockefeller University Press This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 4.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/4.0/).
spellingShingle Brief Definitive Reports
Zhou, Joseph S.
Xing, Wei
Friend, Daniel S.
Austen, K. Frank
Katz, Howard R.
Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title_full Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title_fullStr Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title_full_unstemmed Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title_short Mast cell deficiency in Kit(W-sh) mice does not impair antibody-mediated arthritis
title_sort mast cell deficiency in kit(w-sh) mice does not impair antibody-mediated arthritis
topic Brief Definitive Reports
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2118523/
https://www.ncbi.nlm.nih.gov/pubmed/17998392
http://dx.doi.org/10.1084/jem.20071391
work_keys_str_mv AT zhoujosephs mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis
AT xingwei mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis
AT frienddaniels mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis
AT austenkfrank mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis
AT katzhowardr mastcelldeficiencyinkitwshmicedoesnotimpairantibodymediatedarthritis