Cargando…

Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus

Polyclonal CD4(+) T cell activation is characteristic of spontaneous lupus. As a potential explanation for this phenotype, we hypothesized that T cells from lupus-prone mice are intrinsically hyperresponsive to stimulation with antigen, particularly to those peptide ligands having a low affinity for...

Descripción completa

Detalles Bibliográficos
Autores principales: Vratsanos, George S., Jung, Sungsoo, Park, Yeong-Min, Craft, Joe
Formato: Texto
Lenguaje:English
Publicado: The Rockefeller University Press 2001
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2195926/
https://www.ncbi.nlm.nih.gov/pubmed/11157053
_version_ 1782147957149138944
author Vratsanos, George S.
Jung, Sungsoo
Park, Yeong-Min
Craft, Joe
author_facet Vratsanos, George S.
Jung, Sungsoo
Park, Yeong-Min
Craft, Joe
author_sort Vratsanos, George S.
collection PubMed
description Polyclonal CD4(+) T cell activation is characteristic of spontaneous lupus. As a potential explanation for this phenotype, we hypothesized that T cells from lupus-prone mice are intrinsically hyperresponsive to stimulation with antigen, particularly to those peptide ligands having a low affinity for the T cell receptor (TCR). To test this hypothesis, we backcrossed the α and β chain genes of the AND TCR specific for amino acids 88–104 of pigeon cytochrome C (PCC) to the Fas-intact MRL/Mp(+) (Fas-lpr) and to the H-2(k)–matched control backgrounds B10.BR and CBA/CaJ (MRL.AND, B10.AND, and CBA.AND, respectively), and assessed naive CD4(+) TCR transgenic T cell activation in vitro after its encounter with cognate antigen and lower affinity altered peptide ligands (APLs). MRL.AND T cells, compared with control B10.AND and CBA.AND cells, proliferated more when stimulated with agonist antigen. More strikingly, MRL.AND T cells proliferated significantly more and produced more interleukin 2 when stimulated with the APLs of PCC 88–104, having lower affinity for the transgenic TCR. These results imply that one of the forces driving polyclonal activation of α/β T cells in lupus is an intrinsically heightened response to peptide antigen, particularly those with low affinity for the TCR, independent of the nature of the antigen-presenting cell and degree of costimulation.
format Text
id pubmed-2195926
institution National Center for Biotechnology Information
language English
publishDate 2001
publisher The Rockefeller University Press
record_format MEDLINE/PubMed
spelling pubmed-21959262008-04-14 Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus Vratsanos, George S. Jung, Sungsoo Park, Yeong-Min Craft, Joe J Exp Med Original Article Polyclonal CD4(+) T cell activation is characteristic of spontaneous lupus. As a potential explanation for this phenotype, we hypothesized that T cells from lupus-prone mice are intrinsically hyperresponsive to stimulation with antigen, particularly to those peptide ligands having a low affinity for the T cell receptor (TCR). To test this hypothesis, we backcrossed the α and β chain genes of the AND TCR specific for amino acids 88–104 of pigeon cytochrome C (PCC) to the Fas-intact MRL/Mp(+) (Fas-lpr) and to the H-2(k)–matched control backgrounds B10.BR and CBA/CaJ (MRL.AND, B10.AND, and CBA.AND, respectively), and assessed naive CD4(+) TCR transgenic T cell activation in vitro after its encounter with cognate antigen and lower affinity altered peptide ligands (APLs). MRL.AND T cells, compared with control B10.AND and CBA.AND cells, proliferated more when stimulated with agonist antigen. More strikingly, MRL.AND T cells proliferated significantly more and produced more interleukin 2 when stimulated with the APLs of PCC 88–104, having lower affinity for the transgenic TCR. These results imply that one of the forces driving polyclonal activation of α/β T cells in lupus is an intrinsically heightened response to peptide antigen, particularly those with low affinity for the TCR, independent of the nature of the antigen-presenting cell and degree of costimulation. The Rockefeller University Press 2001-02-05 /pmc/articles/PMC2195926/ /pubmed/11157053 Text en © 2001 The Rockefeller University Press This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 4.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/4.0/).
spellingShingle Original Article
Vratsanos, George S.
Jung, Sungsoo
Park, Yeong-Min
Craft, Joe
Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title_full Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title_fullStr Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title_full_unstemmed Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title_short Cd4(+) T Cells from Lupus-Prone Mice Are Hyperresponsive to T Cell Receptor Engagement with Low and High Affinity Peptide Antigens: A Model to Explain Spontaneous T Cell Activation in Lupus
title_sort cd4(+) t cells from lupus-prone mice are hyperresponsive to t cell receptor engagement with low and high affinity peptide antigens: a model to explain spontaneous t cell activation in lupus
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2195926/
https://www.ncbi.nlm.nih.gov/pubmed/11157053
work_keys_str_mv AT vratsanosgeorges cd4tcellsfromlupuspronemicearehyperresponsivetotcellreceptorengagementwithlowandhighaffinitypeptideantigensamodeltoexplainspontaneoustcellactivationinlupus
AT jungsungsoo cd4tcellsfromlupuspronemicearehyperresponsivetotcellreceptorengagementwithlowandhighaffinitypeptideantigensamodeltoexplainspontaneoustcellactivationinlupus
AT parkyeongmin cd4tcellsfromlupuspronemicearehyperresponsivetotcellreceptorengagementwithlowandhighaffinitypeptideantigensamodeltoexplainspontaneoustcellactivationinlupus
AT craftjoe cd4tcellsfromlupuspronemicearehyperresponsivetotcellreceptorengagementwithlowandhighaffinitypeptideantigensamodeltoexplainspontaneoustcellactivationinlupus