Cargando…
Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice
INTRODUCTION: Obesity is a risk factor for postmenopausal breast cancer and is associated with shortened mammary tumor (MT) latency in MMTV-TGF-α mice with dietary-induced obesity. One link between obesity and breast cancer is the adipokine, leptin. Here, the focus is on diet-induced obesity and MT...
Autores principales: | , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2007
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2246166/ https://www.ncbi.nlm.nih.gov/pubmed/18162139 http://dx.doi.org/10.1186/bcr1840 |
_version_ | 1782150730892705792 |
---|---|
author | Dogan, Soner Hu, Xin Zhang, Yan Maihle, Nita J Grande, Joseph P Cleary, Margot P |
author_facet | Dogan, Soner Hu, Xin Zhang, Yan Maihle, Nita J Grande, Joseph P Cleary, Margot P |
author_sort | Dogan, Soner |
collection | PubMed |
description | INTRODUCTION: Obesity is a risk factor for postmenopausal breast cancer and is associated with shortened mammary tumor (MT) latency in MMTV-TGF-α mice with dietary-induced obesity. One link between obesity and breast cancer is the adipokine, leptin. Here, the focus is on diet-induced obesity and MT and mammary fat pad (MFP) leptin and apoptotic signaling proteins. METHODS: MMTV-TGF-α mice were fed low-fat or high-fat diets from 10 to 85 weeks of age. High-Fat mice were divided into Obesity-Prone and Obesity-Resistant groups based on final body weights. Mice were followed to assess MT development and obtain serum, MFP, and MT. RESULTS: Incidence of palpable MTs was significantly different: Obesity-Prone > Obesity-Resistant > Low-Fat. Serum leptin was significantly higher in Obesity-Prone compared with Obesity-Resistant and Low-Fat mice. Low-Fat mice had higher MFP and MT ObRb (leptin receptor) protein and Jak2 (Janus kinase 2) protein and mRNA levels in comparison with High-Fat mice regardless of body weight. Leptin (mRNA) and pSTAT3 (phosphorylated signal transducer and activator of transcription 3) (mRNA and protein) also were higher in MTs from Low-Fat versus High-Fat mice. Expression of MT and MFP pro-apoptotic proteins was higher in Low-Fat versus High-Fat mice. CONCLUSION: These results confirm a connection between body weight and MT development and between body weight and serum leptin levels. However, diet impacts MT and MFP leptin and apoptosis signaling proteins independently of body weight. |
format | Text |
id | pubmed-2246166 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2007 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-22461662008-02-20 Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice Dogan, Soner Hu, Xin Zhang, Yan Maihle, Nita J Grande, Joseph P Cleary, Margot P Breast Cancer Res Research Article INTRODUCTION: Obesity is a risk factor for postmenopausal breast cancer and is associated with shortened mammary tumor (MT) latency in MMTV-TGF-α mice with dietary-induced obesity. One link between obesity and breast cancer is the adipokine, leptin. Here, the focus is on diet-induced obesity and MT and mammary fat pad (MFP) leptin and apoptotic signaling proteins. METHODS: MMTV-TGF-α mice were fed low-fat or high-fat diets from 10 to 85 weeks of age. High-Fat mice were divided into Obesity-Prone and Obesity-Resistant groups based on final body weights. Mice were followed to assess MT development and obtain serum, MFP, and MT. RESULTS: Incidence of palpable MTs was significantly different: Obesity-Prone > Obesity-Resistant > Low-Fat. Serum leptin was significantly higher in Obesity-Prone compared with Obesity-Resistant and Low-Fat mice. Low-Fat mice had higher MFP and MT ObRb (leptin receptor) protein and Jak2 (Janus kinase 2) protein and mRNA levels in comparison with High-Fat mice regardless of body weight. Leptin (mRNA) and pSTAT3 (phosphorylated signal transducer and activator of transcription 3) (mRNA and protein) also were higher in MTs from Low-Fat versus High-Fat mice. Expression of MT and MFP pro-apoptotic proteins was higher in Low-Fat versus High-Fat mice. CONCLUSION: These results confirm a connection between body weight and MT development and between body weight and serum leptin levels. However, diet impacts MT and MFP leptin and apoptosis signaling proteins independently of body weight. BioMed Central 2007 2007-12-27 /pmc/articles/PMC2246166/ /pubmed/18162139 http://dx.doi.org/10.1186/bcr1840 Text en Copyright © 2007 Dogan et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an open access article distributed under the terms of the Creative Commons Attribution License ( (http://creativecommons.org/licenses/by/2.0) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Dogan, Soner Hu, Xin Zhang, Yan Maihle, Nita J Grande, Joseph P Cleary, Margot P Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title | Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title_full | Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title_fullStr | Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title_full_unstemmed | Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title_short | Effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in MMTV-TGF-α mice |
title_sort | effects of high-fat diet and/or body weight on mammary tumor leptin and apoptosis signaling pathways in mmtv-tgf-α mice |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2246166/ https://www.ncbi.nlm.nih.gov/pubmed/18162139 http://dx.doi.org/10.1186/bcr1840 |
work_keys_str_mv | AT dogansoner effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice AT huxin effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice AT zhangyan effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice AT maihlenitaj effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice AT grandejosephp effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice AT clearymargotp effectsofhighfatdietandorbodyweightonmammarytumorleptinandapoptosissignalingpathwaysinmmtvtgfamice |