Cargando…

Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.

We have successfully established one murine hybridoma that secretes a monoclonal antibody specific for the 77,000 subunit of human DNA polymerase alpha. The results of immunochemical studies, using HDR-854-E4 monoclonal antibody (MAb) and immunoperoxidase detection methods, demonstrate intranuclear...

Descripción completa

Detalles Bibliográficos
Autores principales: Sugawara, I., Uchino, K., Morishita, Y., Yagura, T., Okamoto, S., Mori, S.
Formato: Texto
Lenguaje:English
Publicado: Nature Publishing Group 1989
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2247022/
https://www.ncbi.nlm.nih.gov/pubmed/2765363
_version_ 1782150892305252352
author Sugawara, I.
Uchino, K.
Morishita, Y.
Yagura, T.
Okamoto, S.
Mori, S.
author_facet Sugawara, I.
Uchino, K.
Morishita, Y.
Yagura, T.
Okamoto, S.
Mori, S.
author_sort Sugawara, I.
collection PubMed
description We have successfully established one murine hybridoma that secretes a monoclonal antibody specific for the 77,000 subunit of human DNA polymerase alpha. The results of immunochemical studies, using HDR-854-E4 monoclonal antibody (MAb) and immunoperoxidase detection methods, demonstrate intranuclear and intracytoplasmic localisation of the subunit in all the human culture cell lines tested. The immunoperoxidase reaction product exhibits a diffuse pattern of distribution within the cytoplasm and nucleoplasm, but nucleoli are clearly negative. In cultured cell lines, HeLa and KATO III, more than 95% of the cells are positive, suggesting that the subunit antigens persist throughout the mitotic cycle. No subunit antigen was recognised in resting mononuclear cells (MNC). Immuno-electron microscopic examination of HeLa cells confirms and extends these observations. We have further examined the expression level of the subunit antigen in various normal and cancerous tissues. Strong reaction was observed in proliferating normal and cancer cells such as cancer cells from the gastrointestinal (GI) tract, thyroid, malignant lymphoma, breast, cells in the germinal centres of lymph nodes, epithelial cells in the GI tract and nephrogenic zones in fetal kidney. Finally, we utilised this antibody as a diagnostic tool in biopsies of the thyroid and GI tract. Thyroid cancer was stained positively with this antibody, while follicular adenoma was not. Gastric cancer was stained strongly and adenomatous polyp and hyperplastic polyp were stained moderately. This antibody is not only specific and powerful for application of a novel approach to the complex biochemical mechanisms of mammalian DNA replication, but also useful for distinction between proliferative and non-proliferative lesions. IMAGES:
format Text
id pubmed-2247022
institution National Center for Biotechnology Information
language English
publishDate 1989
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-22470222009-09-10 Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions. Sugawara, I. Uchino, K. Morishita, Y. Yagura, T. Okamoto, S. Mori, S. Br J Cancer Research Article We have successfully established one murine hybridoma that secretes a monoclonal antibody specific for the 77,000 subunit of human DNA polymerase alpha. The results of immunochemical studies, using HDR-854-E4 monoclonal antibody (MAb) and immunoperoxidase detection methods, demonstrate intranuclear and intracytoplasmic localisation of the subunit in all the human culture cell lines tested. The immunoperoxidase reaction product exhibits a diffuse pattern of distribution within the cytoplasm and nucleoplasm, but nucleoli are clearly negative. In cultured cell lines, HeLa and KATO III, more than 95% of the cells are positive, suggesting that the subunit antigens persist throughout the mitotic cycle. No subunit antigen was recognised in resting mononuclear cells (MNC). Immuno-electron microscopic examination of HeLa cells confirms and extends these observations. We have further examined the expression level of the subunit antigen in various normal and cancerous tissues. Strong reaction was observed in proliferating normal and cancer cells such as cancer cells from the gastrointestinal (GI) tract, thyroid, malignant lymphoma, breast, cells in the germinal centres of lymph nodes, epithelial cells in the GI tract and nephrogenic zones in fetal kidney. Finally, we utilised this antibody as a diagnostic tool in biopsies of the thyroid and GI tract. Thyroid cancer was stained positively with this antibody, while follicular adenoma was not. Gastric cancer was stained strongly and adenomatous polyp and hyperplastic polyp were stained moderately. This antibody is not only specific and powerful for application of a novel approach to the complex biochemical mechanisms of mammalian DNA replication, but also useful for distinction between proliferative and non-proliferative lesions. IMAGES: Nature Publishing Group 1989-08 /pmc/articles/PMC2247022/ /pubmed/2765363 Text en https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/.
spellingShingle Research Article
Sugawara, I.
Uchino, K.
Morishita, Y.
Yagura, T.
Okamoto, S.
Mori, S.
Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title_full Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title_fullStr Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title_full_unstemmed Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title_short Intracellular localisation of a subunit of human DNA polymerase alpha affecting primase activity recognised by monoclonal antibody (HDR-854-E4) and its application to distinction between proliferative and non-proliferative lesions.
title_sort intracellular localisation of a subunit of human dna polymerase alpha affecting primase activity recognised by monoclonal antibody (hdr-854-e4) and its application to distinction between proliferative and non-proliferative lesions.
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2247022/
https://www.ncbi.nlm.nih.gov/pubmed/2765363
work_keys_str_mv AT sugawarai intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions
AT uchinok intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions
AT morishitay intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions
AT yagurat intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions
AT okamotos intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions
AT moris intracellularlocalisationofasubunitofhumandnapolymerasealphaaffectingprimaseactivityrecognisedbymonoclonalantibodyhdr854e4anditsapplicationtodistinctionbetweenproliferativeandnonproliferativelesions