Cargando…
The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility
Cyclin-dependent kinases (Cdks) fulfill key functions in many cellular processes, including cell cycle progression and cytoskeletal dynamics. A limited number of Cdk substrates have been identified with few demonstrated to be regulated by Cdk-dependent phosphorylation. We identify on protein express...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
The Rockefeller University Press
2008
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2265402/ https://www.ncbi.nlm.nih.gov/pubmed/18332217 http://dx.doi.org/10.1083/jcb.200707126 |
_version_ | 1782151472998252544 |
---|---|
author | Pandithage, Ruwin Lilischkis, Richard Harting, Kai Wolf, Alexandra Jedamzik, Britta Lüscher-Firzlaff, Juliane Vervoorts, Jörg Lasonder, Edwin Kremmer, Elisabeth Knöll, Bernd Lüscher, Bernhard |
author_facet | Pandithage, Ruwin Lilischkis, Richard Harting, Kai Wolf, Alexandra Jedamzik, Britta Lüscher-Firzlaff, Juliane Vervoorts, Jörg Lasonder, Edwin Kremmer, Elisabeth Knöll, Bernd Lüscher, Bernhard |
author_sort | Pandithage, Ruwin |
collection | PubMed |
description | Cyclin-dependent kinases (Cdks) fulfill key functions in many cellular processes, including cell cycle progression and cytoskeletal dynamics. A limited number of Cdk substrates have been identified with few demonstrated to be regulated by Cdk-dependent phosphorylation. We identify on protein expression arrays novel cyclin E–Cdk2 substrates, including SIRT2, a member of the Sirtuin family of NAD(+)-dependent deacetylases that targets α-tubulin. We define Ser-331 as the site phosphorylated by cyclin E–Cdk2, cyclin A–Cdk2, and p35–Cdk5 both in vitro and in cells. Importantly, phosphorylation at Ser-331 inhibits the catalytic activity of SIRT2. Gain- and loss-of-function studies demonstrate that SIRT2 interfered with cell adhesion and cell migration. In postmitotic hippocampal neurons, neurite outgrowth and growth cone collapse are inhibited by SIRT2. The effects provoked by SIRT2, but not those of a nonphosphorylatable mutant, are antagonized by Cdk-dependent phosphorylation. Collectively, our findings identify a posttranslational mechanism that controls SIRT2 function, and they provide evidence for a novel regulatory circuitry involving Cdks, SIRT2, and microtubules. |
format | Text |
id | pubmed-2265402 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2008 |
publisher | The Rockefeller University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-22654022008-09-10 The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility Pandithage, Ruwin Lilischkis, Richard Harting, Kai Wolf, Alexandra Jedamzik, Britta Lüscher-Firzlaff, Juliane Vervoorts, Jörg Lasonder, Edwin Kremmer, Elisabeth Knöll, Bernd Lüscher, Bernhard J Cell Biol Research Articles Cyclin-dependent kinases (Cdks) fulfill key functions in many cellular processes, including cell cycle progression and cytoskeletal dynamics. A limited number of Cdk substrates have been identified with few demonstrated to be regulated by Cdk-dependent phosphorylation. We identify on protein expression arrays novel cyclin E–Cdk2 substrates, including SIRT2, a member of the Sirtuin family of NAD(+)-dependent deacetylases that targets α-tubulin. We define Ser-331 as the site phosphorylated by cyclin E–Cdk2, cyclin A–Cdk2, and p35–Cdk5 both in vitro and in cells. Importantly, phosphorylation at Ser-331 inhibits the catalytic activity of SIRT2. Gain- and loss-of-function studies demonstrate that SIRT2 interfered with cell adhesion and cell migration. In postmitotic hippocampal neurons, neurite outgrowth and growth cone collapse are inhibited by SIRT2. The effects provoked by SIRT2, but not those of a nonphosphorylatable mutant, are antagonized by Cdk-dependent phosphorylation. Collectively, our findings identify a posttranslational mechanism that controls SIRT2 function, and they provide evidence for a novel regulatory circuitry involving Cdks, SIRT2, and microtubules. The Rockefeller University Press 2008-03-10 /pmc/articles/PMC2265402/ /pubmed/18332217 http://dx.doi.org/10.1083/jcb.200707126 Text en Copyright © 2008, The Rockefeller University Press This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 4.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/4.0/). |
spellingShingle | Research Articles Pandithage, Ruwin Lilischkis, Richard Harting, Kai Wolf, Alexandra Jedamzik, Britta Lüscher-Firzlaff, Juliane Vervoorts, Jörg Lasonder, Edwin Kremmer, Elisabeth Knöll, Bernd Lüscher, Bernhard The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title | The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title_full | The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title_fullStr | The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title_full_unstemmed | The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title_short | The regulation of SIRT2 function by cyclin-dependent kinases affects cell motility |
title_sort | regulation of sirt2 function by cyclin-dependent kinases affects cell motility |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2265402/ https://www.ncbi.nlm.nih.gov/pubmed/18332217 http://dx.doi.org/10.1083/jcb.200707126 |
work_keys_str_mv | AT pandithageruwin theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT lilischkisrichard theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT hartingkai theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT wolfalexandra theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT jedamzikbritta theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT luscherfirzlaffjuliane theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT vervoortsjorg theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT lasonderedwin theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT kremmerelisabeth theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT knollbernd theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT luscherbernhard theregulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT pandithageruwin regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT lilischkisrichard regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT hartingkai regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT wolfalexandra regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT jedamzikbritta regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT luscherfirzlaffjuliane regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT vervoortsjorg regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT lasonderedwin regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT kremmerelisabeth regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT knollbernd regulationofsirt2functionbycyclindependentkinasesaffectscellmotility AT luscherbernhard regulationofsirt2functionbycyclindependentkinasesaffectscellmotility |