Cargando…
Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line,...
Autores principales: | , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2000
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2363249/ https://www.ncbi.nlm.nih.gov/pubmed/10864209 http://dx.doi.org/10.1054/bjoc.2000.1143 |
_version_ | 1782153656599052288 |
---|---|
author | Chen, Y Hughes-Fulford, M |
author_facet | Chen, Y Hughes-Fulford, M |
author_sort | Chen, Y |
collection | PubMed |
description | Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line, PC-3. c-fos mRNA was induced shortly after addition of AA, along with a remarkable increase in PGE (2) production. c-fos expression and PGE (2) production induced by AA was blocked by a cyclo-oxygenase inhibitor, flurbiprofen, suggesting that PGE (2) mediated c-fos induction. Protein kinase A (PKA) inhibitor H-89 abolished induction of c-fos expression by AA, and partially inhibited PGE (2) production. Protein kinase C (PKC) inhibitor GF109203X had no significant effect on c-fos expression or PGE (2) production. Expression of prostaglandin (EP) receptors, which mediate signal transduction from PGE (2) to the cells, was examined by reverse transcription polymerase chain reaction in several human prostate cell lines. EP4 and EP2, which are coupled to the PKA signalling pathway, were expressed in all cells tested. Expression of EP1, which activates the PKC pathway, was not detected. The current study showed that induction of the immediate early gene c-fos by AA is mediated by PGE (2), which activates the PKA pathway via the EP2/4 receptor in the PC-3 cells. © 2000 Cancer Research Campaign |
format | Text |
id | pubmed-2363249 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2000 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-23632492009-09-10 Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells Chen, Y Hughes-Fulford, M Br J Cancer Regular Article Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line, PC-3. c-fos mRNA was induced shortly after addition of AA, along with a remarkable increase in PGE (2) production. c-fos expression and PGE (2) production induced by AA was blocked by a cyclo-oxygenase inhibitor, flurbiprofen, suggesting that PGE (2) mediated c-fos induction. Protein kinase A (PKA) inhibitor H-89 abolished induction of c-fos expression by AA, and partially inhibited PGE (2) production. Protein kinase C (PKC) inhibitor GF109203X had no significant effect on c-fos expression or PGE (2) production. Expression of prostaglandin (EP) receptors, which mediate signal transduction from PGE (2) to the cells, was examined by reverse transcription polymerase chain reaction in several human prostate cell lines. EP4 and EP2, which are coupled to the PKA signalling pathway, were expressed in all cells tested. Expression of EP1, which activates the PKC pathway, was not detected. The current study showed that induction of the immediate early gene c-fos by AA is mediated by PGE (2), which activates the PKA pathway via the EP2/4 receptor in the PC-3 cells. © 2000 Cancer Research Campaign Nature Publishing Group 2000-06 2000-05-18 /pmc/articles/PMC2363249/ /pubmed/10864209 http://dx.doi.org/10.1054/bjoc.2000.1143 Text en Copyright © 2000 Cancer Research Campaign https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Regular Article Chen, Y Hughes-Fulford, M Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title | Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title_full | Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title_fullStr | Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title_full_unstemmed | Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title_short | Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
title_sort | prostaglandin e (2) and the protein kinase a pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells |
topic | Regular Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2363249/ https://www.ncbi.nlm.nih.gov/pubmed/10864209 http://dx.doi.org/10.1054/bjoc.2000.1143 |
work_keys_str_mv | AT cheny prostaglandine2andtheproteinkinaseapathwaymediatearachidonicacidinductionofcfosinhumanprostatecancercells AT hughesfulfordm prostaglandine2andtheproteinkinaseapathwaymediatearachidonicacidinductionofcfosinhumanprostatecancercells |