Cargando…

Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells

Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line,...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Y, Hughes-Fulford, M
Formato: Texto
Lenguaje:English
Publicado: Nature Publishing Group 2000
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2363249/
https://www.ncbi.nlm.nih.gov/pubmed/10864209
http://dx.doi.org/10.1054/bjoc.2000.1143
_version_ 1782153656599052288
author Chen, Y
Hughes-Fulford, M
author_facet Chen, Y
Hughes-Fulford, M
author_sort Chen, Y
collection PubMed
description Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line, PC-3. c-fos mRNA was induced shortly after addition of AA, along with a remarkable increase in PGE (2) production. c-fos expression and PGE (2) production induced by AA was blocked by a cyclo-oxygenase inhibitor, flurbiprofen, suggesting that PGE (2) mediated c-fos induction. Protein kinase A (PKA) inhibitor H-89 abolished induction of c-fos expression by AA, and partially inhibited PGE (2) production. Protein kinase C (PKC) inhibitor GF109203X had no significant effect on c-fos expression or PGE (2) production. Expression of prostaglandin (EP) receptors, which mediate signal transduction from PGE (2) to the cells, was examined by reverse transcription polymerase chain reaction in several human prostate cell lines. EP4 and EP2, which are coupled to the PKA signalling pathway, were expressed in all cells tested. Expression of EP1, which activates the PKC pathway, was not detected. The current study showed that induction of the immediate early gene c-fos by AA is mediated by PGE (2), which activates the PKA pathway via the EP2/4 receptor in the PC-3 cells. © 2000 Cancer Research Campaign
format Text
id pubmed-2363249
institution National Center for Biotechnology Information
language English
publishDate 2000
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-23632492009-09-10 Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells Chen, Y Hughes-Fulford, M Br J Cancer Regular Article Arachidonic acid (AA) is the precursor for prostaglandin E (2)(PGE (2)) synthesis and increases growth of prostate cancer cells. To further elucidate the mechanisms involved in AA-induced prostate cell growth, induction of c-fos expression by AA was investigated in a human prostate cancer cell line, PC-3. c-fos mRNA was induced shortly after addition of AA, along with a remarkable increase in PGE (2) production. c-fos expression and PGE (2) production induced by AA was blocked by a cyclo-oxygenase inhibitor, flurbiprofen, suggesting that PGE (2) mediated c-fos induction. Protein kinase A (PKA) inhibitor H-89 abolished induction of c-fos expression by AA, and partially inhibited PGE (2) production. Protein kinase C (PKC) inhibitor GF109203X had no significant effect on c-fos expression or PGE (2) production. Expression of prostaglandin (EP) receptors, which mediate signal transduction from PGE (2) to the cells, was examined by reverse transcription polymerase chain reaction in several human prostate cell lines. EP4 and EP2, which are coupled to the PKA signalling pathway, were expressed in all cells tested. Expression of EP1, which activates the PKC pathway, was not detected. The current study showed that induction of the immediate early gene c-fos by AA is mediated by PGE (2), which activates the PKA pathway via the EP2/4 receptor in the PC-3 cells. © 2000 Cancer Research Campaign Nature Publishing Group 2000-06 2000-05-18 /pmc/articles/PMC2363249/ /pubmed/10864209 http://dx.doi.org/10.1054/bjoc.2000.1143 Text en Copyright © 2000 Cancer Research Campaign https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/.
spellingShingle Regular Article
Chen, Y
Hughes-Fulford, M
Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title_full Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title_fullStr Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title_full_unstemmed Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title_short Prostaglandin E (2) and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
title_sort prostaglandin e (2) and the protein kinase a pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells
topic Regular Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2363249/
https://www.ncbi.nlm.nih.gov/pubmed/10864209
http://dx.doi.org/10.1054/bjoc.2000.1143
work_keys_str_mv AT cheny prostaglandine2andtheproteinkinaseapathwaymediatearachidonicacidinductionofcfosinhumanprostatecancercells
AT hughesfulfordm prostaglandine2andtheproteinkinaseapathwaymediatearachidonicacidinductionofcfosinhumanprostatecancercells