Cargando…
Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells
We investigated the signalling pathways by which epidermal growth factor (EGF) modulates paclitaxel-induced apoptosis in SiHa human cervical cancer cells. SiHa cells exposed to paclitaxel underwent apoptosis, which was strongly inhibited by EGF. This inhibition of apoptosis by EGF was not altered by...
Autores principales: | , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2001
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2364054/ https://www.ncbi.nlm.nih.gov/pubmed/11461094 http://dx.doi.org/10.1054/bjoc.2001.1910 |
_version_ | 1782153858289500160 |
---|---|
author | Liu, B Fang, M Lu, Y Lu, Y Mills, G B Fan, Z |
author_facet | Liu, B Fang, M Lu, Y Lu, Y Mills, G B Fan, Z |
author_sort | Liu, B |
collection | PubMed |
description | We investigated the signalling pathways by which epidermal growth factor (EGF) modulates paclitaxel-induced apoptosis in SiHa human cervical cancer cells. SiHa cells exposed to paclitaxel underwent apoptosis, which was strongly inhibited by EGF. This inhibition of apoptosis by EGF was not altered by pharmacological blockade of phosphatidylinositol 3′-OH kinase (PI-3K) with the PI-3K specific inhibitor LY294002 or blockade of the mitogen-activated protein kinase (MAPK) kinase (MEK) with the MEK specific inhibitor PD98059, or by transfection of the cells with PI-3K or MEK dominant-negative expression vectors. EGF did not stimulate PI-3K/Akt, MEK/MAPK, or p38 MAPK activity in SiHa cells but did transiently activate the c-Jun NH2-terminal kinase (JNK). Co-exposure of SiHa cells to SB202190 at concentrations that inhibit JNK abolished the protective effect of EGF on SiHa cells against paclitaxel-induced apoptosis. Our findings indicate that the JNK signaling pathway plays an important role in EGF-mediated protection from paclitaxel-induced apoptosis in SiHa cells. © 2001 Cancer Research Campaign http://www.bjcancer.com |
format | Text |
id | pubmed-2364054 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2001 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-23640542009-09-10 Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells Liu, B Fang, M Lu, Y Lu, Y Mills, G B Fan, Z Br J Cancer Regular Article We investigated the signalling pathways by which epidermal growth factor (EGF) modulates paclitaxel-induced apoptosis in SiHa human cervical cancer cells. SiHa cells exposed to paclitaxel underwent apoptosis, which was strongly inhibited by EGF. This inhibition of apoptosis by EGF was not altered by pharmacological blockade of phosphatidylinositol 3′-OH kinase (PI-3K) with the PI-3K specific inhibitor LY294002 or blockade of the mitogen-activated protein kinase (MAPK) kinase (MEK) with the MEK specific inhibitor PD98059, or by transfection of the cells with PI-3K or MEK dominant-negative expression vectors. EGF did not stimulate PI-3K/Akt, MEK/MAPK, or p38 MAPK activity in SiHa cells but did transiently activate the c-Jun NH2-terminal kinase (JNK). Co-exposure of SiHa cells to SB202190 at concentrations that inhibit JNK abolished the protective effect of EGF on SiHa cells against paclitaxel-induced apoptosis. Our findings indicate that the JNK signaling pathway plays an important role in EGF-mediated protection from paclitaxel-induced apoptosis in SiHa cells. © 2001 Cancer Research Campaign http://www.bjcancer.com Nature Publishing Group 2001-07 /pmc/articles/PMC2364054/ /pubmed/11461094 http://dx.doi.org/10.1054/bjoc.2001.1910 Text en Copyright © 2001 Cancer Research Campaign https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Regular Article Liu, B Fang, M Lu, Y Lu, Y Mills, G B Fan, Z Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title | Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title_full | Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title_fullStr | Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title_full_unstemmed | Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title_short | Involvement of JNK-mediated pathway in EGF-mediated protection against paclitaxel-induced apoptosis in SiHa human cervical cancer cells |
title_sort | involvement of jnk-mediated pathway in egf-mediated protection against paclitaxel-induced apoptosis in siha human cervical cancer cells |
topic | Regular Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2364054/ https://www.ncbi.nlm.nih.gov/pubmed/11461094 http://dx.doi.org/10.1054/bjoc.2001.1910 |
work_keys_str_mv | AT liub involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells AT fangm involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells AT luy involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells AT luy involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells AT millsgb involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells AT fanz involvementofjnkmediatedpathwayinegfmediatedprotectionagainstpaclitaxelinducedapoptosisinsihahumancervicalcancercells |