Cargando…

Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells

BACKGROUND: Induction of stem cell differentiation toward functional hepatocytes is hampered by lack of knowledge of the hepatocyte differentiation processes. The overall objective of this project is to characterize key stages in the hepatocyte differentiation process. RESULTS: We established a mous...

Descripción completa

Detalles Bibliográficos
Autores principales: Kheolamai, Pakpoom, Dickson, Alan J
Formato: Texto
Lenguaje:English
Publicado: BioMed Central 2009
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2680860/
https://www.ncbi.nlm.nih.gov/pubmed/19389256
http://dx.doi.org/10.1186/1471-2199-10-35
_version_ 1782166981121671168
author Kheolamai, Pakpoom
Dickson, Alan J
author_facet Kheolamai, Pakpoom
Dickson, Alan J
author_sort Kheolamai, Pakpoom
collection PubMed
description BACKGROUND: Induction of stem cell differentiation toward functional hepatocytes is hampered by lack of knowledge of the hepatocyte differentiation processes. The overall objective of this project is to characterize key stages in the hepatocyte differentiation process. RESULTS: We established a mouse embryonic stem (mES) cell culture system which exhibited changes in gene expression profiles similar to those observed in the development of endodermal and hepatocyte-lineage cells previously described in the normal mouse embryo. Transgenic mES cells were established that permitted isolation of enriched hepatocyte-lineage populations. This approach has isolated mES-derived hepatocyte-lineage cells that express several markers of mature hepatocytes including albumin, glucose-6-phosphatase, tyrosine aminotransferase, cytochrome P450-3a, phosphoenolpyruvate carboxykinase and tryptophan 2,3-dioxygenase. In addition, our results show that the up-regulation of the expression levels of hepatocyte nuclear factor-3α, -4α, -6, and CCAAT-enhancer binding protein-β might be critical for passage into late-stage differentiation towards functional hepatocytes. These data present important steps for definition of regulatory phenomena that direct specific cell fate determination. CONCLUSION: The mES cell culture system generated in this study provides a model for studying transition between stages of the hepatocyte development and has significant potential value for studying the molecular basis of hepatocyte differentiation in vitro.
format Text
id pubmed-2680860
institution National Center for Biotechnology Information
language English
publishDate 2009
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-26808602009-05-13 Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells Kheolamai, Pakpoom Dickson, Alan J BMC Mol Biol Research Article BACKGROUND: Induction of stem cell differentiation toward functional hepatocytes is hampered by lack of knowledge of the hepatocyte differentiation processes. The overall objective of this project is to characterize key stages in the hepatocyte differentiation process. RESULTS: We established a mouse embryonic stem (mES) cell culture system which exhibited changes in gene expression profiles similar to those observed in the development of endodermal and hepatocyte-lineage cells previously described in the normal mouse embryo. Transgenic mES cells were established that permitted isolation of enriched hepatocyte-lineage populations. This approach has isolated mES-derived hepatocyte-lineage cells that express several markers of mature hepatocytes including albumin, glucose-6-phosphatase, tyrosine aminotransferase, cytochrome P450-3a, phosphoenolpyruvate carboxykinase and tryptophan 2,3-dioxygenase. In addition, our results show that the up-regulation of the expression levels of hepatocyte nuclear factor-3α, -4α, -6, and CCAAT-enhancer binding protein-β might be critical for passage into late-stage differentiation towards functional hepatocytes. These data present important steps for definition of regulatory phenomena that direct specific cell fate determination. CONCLUSION: The mES cell culture system generated in this study provides a model for studying transition between stages of the hepatocyte development and has significant potential value for studying the molecular basis of hepatocyte differentiation in vitro. BioMed Central 2009-04-23 /pmc/articles/PMC2680860/ /pubmed/19389256 http://dx.doi.org/10.1186/1471-2199-10-35 Text en Copyright © 2009 Kheolamai and Dickson; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( (http://creativecommons.org/licenses/by/2.0) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Kheolamai, Pakpoom
Dickson, Alan J
Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title_full Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title_fullStr Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title_full_unstemmed Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title_short Liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mES-derived hepatocyte-lineage cells
title_sort liver-enriched transcription factors are critical for the expression of hepatocyte marker genes in mes-derived hepatocyte-lineage cells
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2680860/
https://www.ncbi.nlm.nih.gov/pubmed/19389256
http://dx.doi.org/10.1186/1471-2199-10-35
work_keys_str_mv AT kheolamaipakpoom liverenrichedtranscriptionfactorsarecriticalfortheexpressionofhepatocytemarkergenesinmesderivedhepatocytelineagecells
AT dicksonalanj liverenrichedtranscriptionfactorsarecriticalfortheexpressionofhepatocytemarkergenesinmesderivedhepatocytelineagecells