Tropheryma whipplei in Fecal Samples from Children, Senegal

We tested fecal samples from 150 healthy children 2–10 years of age who lived in rural Senegal and found the prevalence of Tropheryma whipplei was 44%. Unique genotypes were associated with this bacterium. Our findings suggest that T. whipplei is emerging as a highly prevalent pathogen in sub-Sahara...

Descripción completa

Detalles Bibliográficos
Autores principales: Fenollar, Florence, Trape, Jean-François, Bassene, Hubert, Sokhna, Cheikh, Raoult, Didier
Formato: Texto
Lenguaje:English
Publicado: Centers for Disease Control and Prevention 2009
Materias:
Dispatch
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2727305/
https://www.ncbi.nlm.nih.gov/pubmed/19523292
http://dx.doi.org/10.3201/eid1506.090182
_version_ 1782170659044982784
author Fenollar, Florence
Trape, Jean-François
Bassene, Hubert
Sokhna, Cheikh
Raoult, Didier
author_facet Fenollar, Florence
Trape, Jean-François
Bassene, Hubert
Sokhna, Cheikh
Raoult, Didier
author_sort Fenollar, Florence
collection PubMed
description We tested fecal samples from 150 healthy children 2–10 years of age who lived in rural Senegal and found the prevalence of Tropheryma whipplei was 44%. Unique genotypes were associated with this bacterium. Our findings suggest that T. whipplei is emerging as a highly prevalent pathogen in sub-Saharan Africa.
format Text
id pubmed-2727305
institution National Center for Biotechnology Information
language English
publishDate 2009
publisher Centers for Disease Control and Prevention
record_format MEDLINE/PubMed
spelling pubmed-27273052009-08-25 Tropheryma whipplei in Fecal Samples from Children, Senegal Fenollar, Florence Trape, Jean-François Bassene, Hubert Sokhna, Cheikh Raoult, Didier Emerg Infect Dis Dispatch We tested fecal samples from 150 healthy children 2–10 years of age who lived in rural Senegal and found the prevalence of Tropheryma whipplei was 44%. Unique genotypes were associated with this bacterium. Our findings suggest that T. whipplei is emerging as a highly prevalent pathogen in sub-Saharan Africa. Centers for Disease Control and Prevention 2009-06 /pmc/articles/PMC2727305/ /pubmed/19523292 http://dx.doi.org/10.3201/eid1506.090182 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited.
spellingShingle Dispatch
Fenollar, Florence
Trape, Jean-François
Bassene, Hubert
Sokhna, Cheikh
Raoult, Didier
Tropheryma whipplei in Fecal Samples from Children, Senegal
title Tropheryma whipplei in Fecal Samples from Children, Senegal
title_full Tropheryma whipplei in Fecal Samples from Children, Senegal
title_fullStr Tropheryma whipplei in Fecal Samples from Children, Senegal
title_full_unstemmed Tropheryma whipplei in Fecal Samples from Children, Senegal
title_short Tropheryma whipplei in Fecal Samples from Children, Senegal
title_sort tropheryma whipplei in fecal samples from children, senegal
topic Dispatch
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2727305/
https://www.ncbi.nlm.nih.gov/pubmed/19523292
http://dx.doi.org/10.3201/eid1506.090182
work_keys_str_mv AT fenollarflorence tropherymawhippleiinfecalsamplesfromchildrensenegal
AT trapejeanfrancois tropherymawhippleiinfecalsamplesfromchildrensenegal
AT bassenehubert tropherymawhippleiinfecalsamplesfromchildrensenegal
AT sokhnacheikh tropherymawhippleiinfecalsamplesfromchildrensenegal
AT raoultdidier tropherymawhippleiinfecalsamplesfromchildrensenegal

Ejemplares similares