Cargando…
To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes
| Autor principal: | |
|---|---|
| Formato: | Texto |
| Lenguaje: | English |
| Publicado: |
National Institute of Environmental Health Sciences
2010
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2831946/ https://www.ncbi.nlm.nih.gov/pubmed/20123631 |
| _version_ | 1782178297220694016 |
|---|---|
| author | Barrett, Julia R. |
| author_facet | Barrett, Julia R. |
| author_sort | Barrett, Julia R. |
| collection | PubMed |
| description | |
| format | Text |
| id | pubmed-2831946 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2010 |
| publisher | National Institute of Environmental Health Sciences |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-28319462010-03-17 To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes Barrett, Julia R. Environ Health Perspect News National Institute of Environmental Health Sciences 2010-02 /pmc/articles/PMC2831946/ /pubmed/20123631 Text en http://creativecommons.org/publicdomain/mark/1.0/ Publication of EHP lies in the public domain and is therefore without copyright. All text from EHP may be reprinted freely. Use of materials published in EHP should be acknowledged (for example, ?Reproduced with permission from Environmental Health Perspectives?); pertinent reference information should be provided for the article from which the material was reproduced. Articles from EHP, especially the News section, may contain photographs or illustrations copyrighted by other commercial organizations or individuals that may not be used without obtaining prior approval from the holder of the copyright. |
| spellingShingle | News Barrett, Julia R. To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title | To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title_full | To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title_fullStr | To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title_full_unstemmed | To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title_short | To Each His Own: DEHP Yields Species-Specific Metabolic Phenotypes |
| title_sort | to each his own: dehp yields species-specific metabolic phenotypes |
| topic | News |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2831946/ https://www.ncbi.nlm.nih.gov/pubmed/20123631 |
| work_keys_str_mv | AT barrettjuliar toeachhisowndehpyieldsspeciesspecificmetabolicphenotypes |