Cargando…

Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis

Using the currently available proteome databases and based on the concept that a rare sequence is a potential epitope, epitopic sequences derived from Mycobacterium tuberculosis were examined for similarity score to the proteins of the host in which the epitopes were defined. We found that: (i) most...

Descripción completa

Detalles Bibliográficos
Autores principales: Lucchese, Guglielmo, Stufano, Angela, Kanduc, Darja
Formato: Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2010
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2896900/
https://www.ncbi.nlm.nih.gov/pubmed/20625421
http://dx.doi.org/10.1155/2010/832341
_version_ 1782183402508648448
author Lucchese, Guglielmo
Stufano, Angela
Kanduc, Darja
author_facet Lucchese, Guglielmo
Stufano, Angela
Kanduc, Darja
author_sort Lucchese, Guglielmo
collection PubMed
description Using the currently available proteome databases and based on the concept that a rare sequence is a potential epitope, epitopic sequences derived from Mycobacterium tuberculosis were examined for similarity score to the proteins of the host in which the epitopes were defined. We found that: (i) most of the bacterial linear determinants had peptide fragment(s) that were rarely found in the host proteins and (ii) the relationship between low similarity and epitope definition appears potentially applicable to T-cell determinants. The data confirmed the hypothesis that low-sequence similarity shapes or determines the epitope definition at the molecular level and provides a potential tool for designing new approaches to prevent, diagnose, and treat tuberculosis and other infectious diseases.
format Text
id pubmed-2896900
institution National Center for Biotechnology Information
language English
publishDate 2010
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-28969002010-07-12 Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis Lucchese, Guglielmo Stufano, Angela Kanduc, Darja J Biomed Biotechnol Methodology Report Using the currently available proteome databases and based on the concept that a rare sequence is a potential epitope, epitopic sequences derived from Mycobacterium tuberculosis were examined for similarity score to the proteins of the host in which the epitopes were defined. We found that: (i) most of the bacterial linear determinants had peptide fragment(s) that were rarely found in the host proteins and (ii) the relationship between low similarity and epitope definition appears potentially applicable to T-cell determinants. The data confirmed the hypothesis that low-sequence similarity shapes or determines the epitope definition at the molecular level and provides a potential tool for designing new approaches to prevent, diagnose, and treat tuberculosis and other infectious diseases. Hindawi Publishing Corporation 2010 2010-06-03 /pmc/articles/PMC2896900/ /pubmed/20625421 http://dx.doi.org/10.1155/2010/832341 Text en Copyright © 2010 Guglielmo Lucchese et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Methodology Report
Lucchese, Guglielmo
Stufano, Angela
Kanduc, Darja
Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title_full Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title_fullStr Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title_full_unstemmed Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title_short Proposing Low-Similarity Peptide Vaccines against Mycobacterium tuberculosis
title_sort proposing low-similarity peptide vaccines against mycobacterium tuberculosis
topic Methodology Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2896900/
https://www.ncbi.nlm.nih.gov/pubmed/20625421
http://dx.doi.org/10.1155/2010/832341
work_keys_str_mv AT luccheseguglielmo proposinglowsimilaritypeptidevaccinesagainstmycobacteriumtuberculosis
AT stufanoangela proposinglowsimilaritypeptidevaccinesagainstmycobacteriumtuberculosis
AT kanducdarja proposinglowsimilaritypeptidevaccinesagainstmycobacteriumtuberculosis