Cargando…
Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination
BACKGROUND: Streptococcus dysgalactiae subspecies equisimilis (SDSE) is an emerging global pathogen that can colonize and infect humans. Although most SDSE isolates possess the Lancefield group G carbohydrate, a significant minority have the group C carbohydrate. Isolates are further sub-typed on th...
Autores principales: | , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2010
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2909212/ https://www.ncbi.nlm.nih.gov/pubmed/20668530 http://dx.doi.org/10.1371/journal.pone.0011741 |
_version_ | 1782184288252329984 |
---|---|
author | McMillan, David J. Bessen, Debra E. Pinho, Marcos Ford, Candace Hall, Gerod S. Melo-Cristino, José Ramirez, Mário |
author_facet | McMillan, David J. Bessen, Debra E. Pinho, Marcos Ford, Candace Hall, Gerod S. Melo-Cristino, José Ramirez, Mário |
author_sort | McMillan, David J. |
collection | PubMed |
description | BACKGROUND: Streptococcus dysgalactiae subspecies equisimilis (SDSE) is an emerging global pathogen that can colonize and infect humans. Although most SDSE isolates possess the Lancefield group G carbohydrate, a significant minority have the group C carbohydrate. Isolates are further sub-typed on the basis of differences within the emm gene. To gain a better understanding of their molecular epidemiology and evolutionary relationships, multilocus sequence typing (MLST) analysis was performed on SDSE isolates collected from Australia, Europe and North America. METHODOLOGY/PRINCIPAL FINDINGS: The 178 SDSE isolates, representing 37 emm types, segregate into 80 distinct sequence types (STs) that form 17 clonal complexes (CCs). Eight STs recovered from all three continents account for >50% of the isolates. Thus, a small number of STs are highly prevalent and have a wide geographic distribution. Both ST and CC strongly correlate with group carbohydrate. In contrast, eleven STs were associated with >1 emm type, suggestive of recombinational replacements involving the emm gene; furthermore, 35% of the emm types are associated with genetically distant STs. Data also reveal a history of extensive inter- and intra-species recombination involving the housekeeping genes used for MLST. Sequence analysis of single locus variants identified through goeBURST indicates that genetic change mediated by recombination occurred ∼4.4 times more frequently than by point mutation. CONCLUSIONS/SIGNIFICANCE: A few genetic lineages with an intercontinental distribution dominate among SDSE causing infections in humans. The distinction between group C and G isolates reflects recent evolution, and no long-term genetic isolation between them was found. Lateral gene transfer and recombination involving housekeeping genes and the emm gene are important mechanisms driving genetic variability in the SDSE population. |
format | Text |
id | pubmed-2909212 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2010 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-29092122010-07-28 Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination McMillan, David J. Bessen, Debra E. Pinho, Marcos Ford, Candace Hall, Gerod S. Melo-Cristino, José Ramirez, Mário PLoS One Research Article BACKGROUND: Streptococcus dysgalactiae subspecies equisimilis (SDSE) is an emerging global pathogen that can colonize and infect humans. Although most SDSE isolates possess the Lancefield group G carbohydrate, a significant minority have the group C carbohydrate. Isolates are further sub-typed on the basis of differences within the emm gene. To gain a better understanding of their molecular epidemiology and evolutionary relationships, multilocus sequence typing (MLST) analysis was performed on SDSE isolates collected from Australia, Europe and North America. METHODOLOGY/PRINCIPAL FINDINGS: The 178 SDSE isolates, representing 37 emm types, segregate into 80 distinct sequence types (STs) that form 17 clonal complexes (CCs). Eight STs recovered from all three continents account for >50% of the isolates. Thus, a small number of STs are highly prevalent and have a wide geographic distribution. Both ST and CC strongly correlate with group carbohydrate. In contrast, eleven STs were associated with >1 emm type, suggestive of recombinational replacements involving the emm gene; furthermore, 35% of the emm types are associated with genetically distant STs. Data also reveal a history of extensive inter- and intra-species recombination involving the housekeeping genes used for MLST. Sequence analysis of single locus variants identified through goeBURST indicates that genetic change mediated by recombination occurred ∼4.4 times more frequently than by point mutation. CONCLUSIONS/SIGNIFICANCE: A few genetic lineages with an intercontinental distribution dominate among SDSE causing infections in humans. The distinction between group C and G isolates reflects recent evolution, and no long-term genetic isolation between them was found. Lateral gene transfer and recombination involving housekeeping genes and the emm gene are important mechanisms driving genetic variability in the SDSE population. Public Library of Science 2010-07-23 /pmc/articles/PMC2909212/ /pubmed/20668530 http://dx.doi.org/10.1371/journal.pone.0011741 Text en McMillan et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article McMillan, David J. Bessen, Debra E. Pinho, Marcos Ford, Candace Hall, Gerod S. Melo-Cristino, José Ramirez, Mário Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title | Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title_full | Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title_fullStr | Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title_full_unstemmed | Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title_short | Population Genetics of Streptococcus dysgalactiae Subspecies equisimilis Reveals Widely Dispersed Clones and Extensive Recombination |
title_sort | population genetics of streptococcus dysgalactiae subspecies equisimilis reveals widely dispersed clones and extensive recombination |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2909212/ https://www.ncbi.nlm.nih.gov/pubmed/20668530 http://dx.doi.org/10.1371/journal.pone.0011741 |
work_keys_str_mv | AT mcmillandavidj populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT bessendebrae populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT pinhomarcos populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT fordcandace populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT hallgerods populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT melocristinojose populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination AT ramirezmario populationgeneticsofstreptococcusdysgalactiaesubspeciesequisimilisrevealswidelydispersedclonesandextensiverecombination |