Cargando…
Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands
BACKGROUND: Mucoepidermoid carcinoma (MEC) shows differences in biological behaviour depending mainly on its histological grade. High-grade tumours usually have an aggressive biological course and they require additional oncological treatment after surgery. METHODS: In a series of 43 MECs of the sal...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2010
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2939786/ https://www.ncbi.nlm.nih.gov/pubmed/20664595 http://dx.doi.org/10.1038/sj.bjc.6605788 |
_version_ | 1782186774108307456 |
---|---|
author | Lujan, B Hakim, S Moyano, S Nadal, A Caballero, M Diaz, A Valera, A Carrera, M Cardesa, A Alos, L |
author_facet | Lujan, B Hakim, S Moyano, S Nadal, A Caballero, M Diaz, A Valera, A Carrera, M Cardesa, A Alos, L |
author_sort | Lujan, B |
collection | PubMed |
description | BACKGROUND: Mucoepidermoid carcinoma (MEC) shows differences in biological behaviour depending mainly on its histological grade. High-grade tumours usually have an aggressive biological course and they require additional oncological treatment after surgery. METHODS: In a series of 43 MECs of the salivary glands, we studied the epidermal growth factor receptor (EGFR) gene by using dual-colour chromogenic in situ hybridisation (CISH). Moreover, we assessed the protein expressions of the EGFR and the activated extracellular signal-regulated kinases (pERK1/2) by using immunohistochemistry. These results were correlated with the histological grade of the tumours and the outcome of the patients. RESULTS: The CISH study demonstrated a high-EGFR gene copy number, with balanced chromosome 7 polysomy, in 8 out of 11 high-grade MECs (72.7%), whereas 27 low-grade and 15 intermediate-grade tumours had a normal EGFR gene copy number (P<0.001). The EGFR gene gains correlated with disease-free interval (P=0.003) and overall survival of the patients (P=0.019). The EGFR protein expression had a significant correlation with the histological grade of the tumours but not with the outcome of the patients. The pERK1/2 expression correlated with histological grade of tumours (P<0.001), disease-free interval (P=0.004) and overall survival (P=0.001). CONCLUSIONS: The EGFR/ERK pathway is activated in high-grade MECs with aggressive behaviour. Patients with these tumours who require oncological treatment in addition to surgery could benefit from EGFR and mitogen-activated protein kinase pathway inhibitors. |
format | Text |
id | pubmed-2939786 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2010 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-29397862011-08-10 Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands Lujan, B Hakim, S Moyano, S Nadal, A Caballero, M Diaz, A Valera, A Carrera, M Cardesa, A Alos, L Br J Cancer Molecular Diagnostics BACKGROUND: Mucoepidermoid carcinoma (MEC) shows differences in biological behaviour depending mainly on its histological grade. High-grade tumours usually have an aggressive biological course and they require additional oncological treatment after surgery. METHODS: In a series of 43 MECs of the salivary glands, we studied the epidermal growth factor receptor (EGFR) gene by using dual-colour chromogenic in situ hybridisation (CISH). Moreover, we assessed the protein expressions of the EGFR and the activated extracellular signal-regulated kinases (pERK1/2) by using immunohistochemistry. These results were correlated with the histological grade of the tumours and the outcome of the patients. RESULTS: The CISH study demonstrated a high-EGFR gene copy number, with balanced chromosome 7 polysomy, in 8 out of 11 high-grade MECs (72.7%), whereas 27 low-grade and 15 intermediate-grade tumours had a normal EGFR gene copy number (P<0.001). The EGFR gene gains correlated with disease-free interval (P=0.003) and overall survival of the patients (P=0.019). The EGFR protein expression had a significant correlation with the histological grade of the tumours but not with the outcome of the patients. The pERK1/2 expression correlated with histological grade of tumours (P<0.001), disease-free interval (P=0.004) and overall survival (P=0.001). CONCLUSIONS: The EGFR/ERK pathway is activated in high-grade MECs with aggressive behaviour. Patients with these tumours who require oncological treatment in addition to surgery could benefit from EGFR and mitogen-activated protein kinase pathway inhibitors. Nature Publishing Group 2010-08-10 2010-07-27 /pmc/articles/PMC2939786/ /pubmed/20664595 http://dx.doi.org/10.1038/sj.bjc.6605788 Text en Copyright © 2010 Cancer Research UK https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Molecular Diagnostics Lujan, B Hakim, S Moyano, S Nadal, A Caballero, M Diaz, A Valera, A Carrera, M Cardesa, A Alos, L Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title | Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title_full | Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title_fullStr | Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title_full_unstemmed | Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title_short | Activation of the EGFR/ERK pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
title_sort | activation of the egfr/erk pathway in high-grade mucoepidermoid carcinomas of the salivary glands |
topic | Molecular Diagnostics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2939786/ https://www.ncbi.nlm.nih.gov/pubmed/20664595 http://dx.doi.org/10.1038/sj.bjc.6605788 |
work_keys_str_mv | AT lujanb activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT hakims activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT moyanos activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT nadala activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT caballerom activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT diaza activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT valeraa activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT carreram activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT cardesaa activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands AT alosl activationoftheegfrerkpathwayinhighgrademucoepidermoidcarcinomasofthesalivaryglands |