Cargando…
Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells
Transcriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portrait...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2010
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2996331/ https://www.ncbi.nlm.nih.gov/pubmed/21170361 http://dx.doi.org/10.1371/journal.pgen.1001231 |
_version_ | 1782193185508818944 |
---|---|
author | Jürchott, Karsten Kuban, Ralf-Jürgen Krech, Till Blüthgen, Nils Stein, Ulrike Walther, Wolfgang Friese, Christian Kiełbasa, Szymon M. Ungethüm, Ute Lund, Per Knösel, Thomas Kemmner, Wolfgang Morkel, Markus Fritzmann, Johannes Schlag, Peter M. Birchmeier, Walter Krueger, Tammo Sperling, Silke Sers, Christine Royer, Hans-Dieter Herzel, Hanspeter Schäfer, Reinhold |
author_facet | Jürchott, Karsten Kuban, Ralf-Jürgen Krech, Till Blüthgen, Nils Stein, Ulrike Walther, Wolfgang Friese, Christian Kiełbasa, Szymon M. Ungethüm, Ute Lund, Per Knösel, Thomas Kemmner, Wolfgang Morkel, Markus Fritzmann, Johannes Schlag, Peter M. Birchmeier, Walter Krueger, Tammo Sperling, Silke Sers, Christine Royer, Hans-Dieter Herzel, Hanspeter Schäfer, Reinhold |
author_sort | Jürchott, Karsten |
collection | PubMed |
description | Transcriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portraits, e.g. in cancer. However, mechanistic insights into the regulatory principles governing global transcriptional changes are lagging behind extensive compilations of deregulated genes. To identify regulators of transcriptome alterations, we used an integrated approach combining transcriptional profiling of colorectal cancer cell lines treated with inhibitors targeting the receptor tyrosine kinase (RTK)/RAS/mitogen-activated protein kinase pathway, computational prediction of regulatory elements in promoters of co-regulated genes, chromatin-based and functional cellular assays. We identified commonly co-regulated, proliferation-associated target genes that respond to the MAPK pathway. We recognized E2F and NFY transcription factor binding sites as prevalent motifs in those pathway-responsive genes and confirmed the predicted regulatory role of Y-box binding protein 1 (YBX1) by reporter gene, gel shift, and chromatin immunoprecipitation assays. We also validated the MAPK-dependent gene signature in colorectal cancers and provided evidence for the association of YBX1 with poor prognosis in colorectal cancer patients. This suggests that MEK/ERK-dependent, YBX1-regulated target genes are involved in executing malignant properties. |
format | Text |
id | pubmed-2996331 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2010 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-29963312010-12-17 Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells Jürchott, Karsten Kuban, Ralf-Jürgen Krech, Till Blüthgen, Nils Stein, Ulrike Walther, Wolfgang Friese, Christian Kiełbasa, Szymon M. Ungethüm, Ute Lund, Per Knösel, Thomas Kemmner, Wolfgang Morkel, Markus Fritzmann, Johannes Schlag, Peter M. Birchmeier, Walter Krueger, Tammo Sperling, Silke Sers, Christine Royer, Hans-Dieter Herzel, Hanspeter Schäfer, Reinhold PLoS Genet Research Article Transcriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portraits, e.g. in cancer. However, mechanistic insights into the regulatory principles governing global transcriptional changes are lagging behind extensive compilations of deregulated genes. To identify regulators of transcriptome alterations, we used an integrated approach combining transcriptional profiling of colorectal cancer cell lines treated with inhibitors targeting the receptor tyrosine kinase (RTK)/RAS/mitogen-activated protein kinase pathway, computational prediction of regulatory elements in promoters of co-regulated genes, chromatin-based and functional cellular assays. We identified commonly co-regulated, proliferation-associated target genes that respond to the MAPK pathway. We recognized E2F and NFY transcription factor binding sites as prevalent motifs in those pathway-responsive genes and confirmed the predicted regulatory role of Y-box binding protein 1 (YBX1) by reporter gene, gel shift, and chromatin immunoprecipitation assays. We also validated the MAPK-dependent gene signature in colorectal cancers and provided evidence for the association of YBX1 with poor prognosis in colorectal cancer patients. This suggests that MEK/ERK-dependent, YBX1-regulated target genes are involved in executing malignant properties. Public Library of Science 2010-12-02 /pmc/articles/PMC2996331/ /pubmed/21170361 http://dx.doi.org/10.1371/journal.pgen.1001231 Text en Jürchott et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Jürchott, Karsten Kuban, Ralf-Jürgen Krech, Till Blüthgen, Nils Stein, Ulrike Walther, Wolfgang Friese, Christian Kiełbasa, Szymon M. Ungethüm, Ute Lund, Per Knösel, Thomas Kemmner, Wolfgang Morkel, Markus Fritzmann, Johannes Schlag, Peter M. Birchmeier, Walter Krueger, Tammo Sperling, Silke Sers, Christine Royer, Hans-Dieter Herzel, Hanspeter Schäfer, Reinhold Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title | Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title_full | Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title_fullStr | Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title_full_unstemmed | Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title_short | Identification of Y-Box Binding Protein 1 As a Core Regulator of MEK/ERK Pathway-Dependent Gene Signatures in Colorectal Cancer Cells |
title_sort | identification of y-box binding protein 1 as a core regulator of mek/erk pathway-dependent gene signatures in colorectal cancer cells |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2996331/ https://www.ncbi.nlm.nih.gov/pubmed/21170361 http://dx.doi.org/10.1371/journal.pgen.1001231 |
work_keys_str_mv | AT jurchottkarsten identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT kubanralfjurgen identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT krechtill identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT bluthgennils identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT steinulrike identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT waltherwolfgang identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT friesechristian identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT kiełbasaszymonm identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT ungethumute identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT lundper identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT knoselthomas identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT kemmnerwolfgang identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT morkelmarkus identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT fritzmannjohannes identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT schlagpeterm identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT birchmeierwalter identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT kruegertammo identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT sperlingsilke identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT serschristine identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT royerhansdieter identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT herzelhanspeter identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells AT schaferreinhold identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells |